KEGG   Trichomonas vaginalis: TVAG_450940Help
Entry
TVAG_450940       CDS       T01022                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
tva  Trichomonas vaginalis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tva03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 187 aa AA seqDB search
MFYRAPGSKAADNYEKNIHTLGSFNTIEEFWSIYSHLKRPNDLEPPTDYHLFRNGIRAIW
EDQDNVKGGKWIIRLKKGLGSYYWERLIMALIGEQFPVDALGAVISVRYPEDIISLWNRT
ASDDKVRHEICRALCSALELPPDTKLEYKQHYDAVRDHSSFRNTVIYQAGTDEPFEIPQK
KVGNGKK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgttttacagagcacctggctcaaaagcagctgacaattacgagaaaaatatacataca
ctcggtagttttaatacaatcgaagaattttggtcaatatatagtcaccttaaacgtcca
aatgacttagaaccaccaacagactatcatctatttaggaatggaatacgcgcaatttgg
gaagaccaagataacgtgaaaggaggaaaatggattattagattaaaaaagggattaggc
tcatactactgggaaagacttattatggcattaattggagaacaatttccagtagatgcc
cttggagcagttatttctgttagatatcctgaagatataattagtttatggaatagaact
gcatcagatgataaagtacgccatgaaatttgccgtgcattatgctcggcgctcgaatta
ccaccagatacaaaattggaatacaaacagcactatgacgctgttagagatcactcttct
ttcagaaatactgttatctaccaggctggaactgacgaaccatttgaaattcctcaaaag
aaggtaggaaatggtaaaaaatga

DBGET integrated database retrieval system