KEGG   Trichomonas vaginalis: TVAG_453180Help
Entry
TVAG_453180       CDS       T01022                                 

Definition
starch branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tva  Trichomonas vaginalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TVAG_453180
Enzymes [BR:tva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TVAG_453180
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVAG_453180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 671 aa AA seqDB search
MQILVDNPWLEPYNNKIQERMNDYLNAKAFISQNEGSLEKFSQAYKEYGIHKVDGGIIYK
EWAPNAVEIHLVGDFNDWNVDDPYTKCVKEDVYGHFKLFIPDYEGRPVIMHDSKVKCVLK
LNNGETVWRIPAWIQYTRQNEHDVEYNGVFWNPPHKYVFKNPKPGPLDDALLIYEAHIGM
AGPEHRVHTYKEFEKNVLPVVKKNGYNAIQLMGIMEHPYYGSYGYQVTNFFAVSSRFGTP
DDLKSLIDTAHWMGICVFLDLVHSHASRNVSEGLNYFDGSEHQYFHPGERGNHPFWDSRC
FDYGSYEVRRFLLSNVRFYLEEYNFDGFRFDGVTSILYVDHGKKFDYSSINEYFDDNVDR
DAITYLMLANDIIHSYDRNAITIAEDVSGMIGIARSIKDGGIGFDYRLSMGVPDLWIKML
KDQWDEEWDMENLAKELLNRPYKEKTIAYCESHDQALVGDKTIAFWLMDAEMYTNMSCLK
PETVCIARGIALHKLIRFITFTLGGQGYLNFMGNEFGHPEWIDFPREGNNYSYQHCIRQF
DLPVTDHLRYKYLLRFDNAMLSLEQREHFLSSDNINLILSDNESKVIAFERGNLLFVFNF
HSTFSYSDFEVGVSQPGDYKCILSSDDDWFGGHNCIDKNVTHTSFMGPWQGCPHKIPLYI
PCRTASVYKKF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgcagattctagttgataatccatggctcgaaccctacaataacaaaatacaggaaaga
atgaatgattatcttaatgctaaagcttttatttcccaaaacgaaggctctttagaaaaa
ttttctcaagcatacaaagaatacggcattcataaagtggatggaggtattatttataaa
gaatgggctcctaatgccgtagaaatccacttggttggcgattttaacgattggaatgtc
gatgatccatacacgaaatgtgttaaagaggacgtttatggccattttaaattatttata
ccagattatgaaggaagaccagtcattatgcacgattccaaagtaaaatgcgtattaaaa
ctcaataatggcgaaactgtttggagaattccagcatggatccaatatacacgccaaaat
gaacatgatgttgaatacaatggtgtcttttggaatcctcctcacaaatacgtcttcaaa
aatccaaaaccaggaccacttgatgacgcattgctcatctacgaagcacatatcggcatg
gccggtcctgaacatagagttcatacctataaagagtttgaaaaaaacgttttacccgtt
gtaaagaagaacggctacaatgcgatccaactgatgggaattatggaacacccatactat
ggttcctacggttaccaagtcacaaacttcttcgctgtctcatctcgcttcggtacgcca
gatgacttgaaatccctcatagatacagcccactggatgggtatttgtgtcttcctcgac
ctcgtacactcccatgcttcaagaaatgtctctgaaggtctgaattattttgacgggtca
gaacatcagtacttccatccaggcgagcgtggaaatcatcctttctgggactcaagatgc
ttcgattacggatcatatgaagtcagacgcttcttattatcgaatgtcagattttatctc
gaagaatacaattttgatggctttagatttgacggtgttacatcaatcctctacgttgat
catggaaagaagttcgattactcatccatcaacgaatatttcgatgataatgttgacagg
gacgcaattacatatttaatgctcgcaaatgatatcatccacagctacgatcgcaatgcc
attacaattgccgaagacgtctccggaatgatcggaattgctcgttcgatcaaagacggc
ggaatcggttttgattacaggctctccatgggcgtgccagatttgtggatcaaaatgctg
aaagaccaatgggatgaagaatgggatatggaaaaccttgctaaagagttattgaacaga
ccatacaaagaaaagacaattgcttattgtgaatcacacgaccaagcacttgttggcgat
aaaacaattgctttttggctgatggacgctgaaatgtacacaaacatgtcctgtttgaag
ccagaaacggtctgtatcgcaagaggaattgctcttcacaaactcattcgtttcattact
ttcacattaggtggacaaggatatttgaattttatgggtaatgaatttggtcatcctgaa
tggattgacttccctcgtgaaggaaataactattcataccaacactgcatcagacaattc
gatcttcctgttactgaccacttaagatacaaatatcttttaagatttgacaacgcgatg
cttagtcttgagcagcgtgaacatttcttgtcttctgataatattaatcttattctaagt
gataatgaaagcaaagttattgctttcgagcgcggaaatctcttatttgtttttaacttc
cattctacattctcttactccgatttcgaagttggtgtcagtcagcctggtgactacaaa
tgcatcctctcgtcagatgatgactggtttggcggtcacaactgcattgataaaaatgtc
acccatacttcgttcatgggaccatggcagggatgcccccataagattcctttgtatatc
ccttgcagaactgcatctgtttataagaagttttaa

DBGET integrated database retrieval system