KEGG   Trichomonas vaginalis: TVAG_453180Help
Entry
TVAG_453180       CDS       T01022                                 

Definition
starch branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tva  Trichomonas vaginalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tva00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 671 aa AA seqDB search
MQILVDNPWLEPYNNKIQERMNDYLNAKAFISQNEGSLEKFSQAYKEYGIHKVDGGIIYK
EWAPNAVEIHLVGDFNDWNVDDPYTKCVKEDVYGHFKLFIPDYEGRPVIMHDSKVKCVLK
LNNGETVWRIPAWIQYTRQNEHDVEYNGVFWNPPHKYVFKNPKPGPLDDALLIYEAHIGM
AGPEHRVHTYKEFEKNVLPVVKKNGYNAIQLMGIMEHPYYGSYGYQVTNFFAVSSRFGTP
DDLKSLIDTAHWMGICVFLDLVHSHASRNVSEGLNYFDGSEHQYFHPGERGNHPFWDSRC
FDYGSYEVRRFLLSNVRFYLEEYNFDGFRFDGVTSILYVDHGKKFDYSSINEYFDDNVDR
DAITYLMLANDIIHSYDRNAITIAEDVSGMIGIARSIKDGGIGFDYRLSMGVPDLWIKML
KDQWDEEWDMENLAKELLNRPYKEKTIAYCESHDQALVGDKTIAFWLMDAEMYTNMSCLK
PETVCIARGIALHKLIRFITFTLGGQGYLNFMGNEFGHPEWIDFPREGNNYSYQHCIRQF
DLPVTDHLRYKYLLRFDNAMLSLEQREHFLSSDNINLILSDNESKVIAFERGNLLFVFNF
HSTFSYSDFEVGVSQPGDYKCILSSDDDWFGGHNCIDKNVTHTSFMGPWQGCPHKIPLYI
PCRTASVYKKF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgcagattctagttgataatccatggctcgaaccctacaataacaaaatacaggaaaga
atgaatgattatcttaatgctaaagcttttatttcccaaaacgaaggctctttagaaaaa
ttttctcaagcatacaaagaatacggcattcataaagtggatggaggtattatttataaa
gaatgggctcctaatgccgtagaaatccacttggttggcgattttaacgattggaatgtc
gatgatccatacacgaaatgtgttaaagaggacgtttatggccattttaaattatttata
ccagattatgaaggaagaccagtcattatgcacgattccaaagtaaaatgcgtattaaaa
ctcaataatggcgaaactgtttggagaattccagcatggatccaatatacacgccaaaat
gaacatgatgttgaatacaatggtgtcttttggaatcctcctcacaaatacgtcttcaaa
aatccaaaaccaggaccacttgatgacgcattgctcatctacgaagcacatatcggcatg
gccggtcctgaacatagagttcatacctataaagagtttgaaaaaaacgttttacccgtt
gtaaagaagaacggctacaatgcgatccaactgatgggaattatggaacacccatactat
ggttcctacggttaccaagtcacaaacttcttcgctgtctcatctcgcttcggtacgcca
gatgacttgaaatccctcatagatacagcccactggatgggtatttgtgtcttcctcgac
ctcgtacactcccatgcttcaagaaatgtctctgaaggtctgaattattttgacgggtca
gaacatcagtacttccatccaggcgagcgtggaaatcatcctttctgggactcaagatgc
ttcgattacggatcatatgaagtcagacgcttcttattatcgaatgtcagattttatctc
gaagaatacaattttgatggctttagatttgacggtgttacatcaatcctctacgttgat
catggaaagaagttcgattactcatccatcaacgaatatttcgatgataatgttgacagg
gacgcaattacatatttaatgctcgcaaatgatatcatccacagctacgatcgcaatgcc
attacaattgccgaagacgtctccggaatgatcggaattgctcgttcgatcaaagacggc
ggaatcggttttgattacaggctctccatgggcgtgccagatttgtggatcaaaatgctg
aaagaccaatgggatgaagaatgggatatggaaaaccttgctaaagagttattgaacaga
ccatacaaagaaaagacaattgcttattgtgaatcacacgaccaagcacttgttggcgat
aaaacaattgctttttggctgatggacgctgaaatgtacacaaacatgtcctgtttgaag
ccagaaacggtctgtatcgcaagaggaattgctcttcacaaactcattcgtttcattact
ttcacattaggtggacaaggatatttgaattttatgggtaatgaatttggtcatcctgaa
tggattgacttccctcgtgaaggaaataactattcataccaacactgcatcagacaattc
gatcttcctgttactgaccacttaagatacaaatatcttttaagatttgacaacgcgatg
cttagtcttgagcagcgtgaacatttcttgtcttctgataatattaatcttattctaagt
gataatgaaagcaaagttattgctttcgagcgcggaaatctcttatttgtttttaacttc
cattctacattctcttactccgatttcgaagttggtgtcagtcagcctggtgactacaaa
tgcatcctctcgtcagatgatgactggtttggcggtcacaactgcattgataaaaatgtc
acccatacttcgttcatgggaccatggcagggatgcccccataagattcctttgtatatc
ccttgcagaactgcatctgtttataagaagttttaa

DBGET integrated database retrieval system