KEGG   Trichomonas vaginalis: TVAG_455660Help
Entry
TVAG_455660       CDS       T01022                                 

Definition
Clan CA, family C12, ubiquitin hydrolase-like cysteine peptidase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
tva  Trichomonas vaginalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 228 aa AA seqDB search
MSSEDYGIIPIENSPEMLTKMADSIGADTSKFTLSTIYSFDEEILATIPQPIKAIILLFP
FGKENSPIRTRHSGEKVPEGDLPYYTKQKVQNLCGTIALIHAILNNLDIIPLKADSILDK
FYKHTKSLTPDERGLELTKEKELFAIHNAISNASNGAQEGEKALTHYSCFIEHAGHIWEL
DGRLSNMVDHGVSSNFATQVFQIIQTEFIDKLEGMEKFMLDVVALSKI
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcgaagattatggaatcattcctatcgagaattcaccagagatgctaacaaag
atggcagattctattggtgctgatacatcaaagttcactctttcaactatctattctttt
gatgaagaaattcttgccacaattcctcaacctatcaaagctatcatattattatttcca
tttggaaaagaaaatagtccaataagaacacgccattctggagagaaagtgccagaaggg
gatttaccttattatactaaacaaaaagtacaaaatttatgtggtactattgcattaatt
cacgcaattttgaacaatttagatattatcccattgaaagcagattcaattctcgacaaa
ttttataaacatacaaaatctttgactcctgatgagcgtggtcttgaacttaccaaagaa
aaagaactgtttgcaatacataacgccatatctaatgcttcaaatggagctcaagaagga
gaaaaagctttaactcattactcatgctttattgagcatgccggccacatttgggagctt
gatggaagactttcaaacatggttgaccatggagtttcttctaattttgctacccaagta
tttcaaataatacaaaccgaattcatcgacaaacttgaaggaatggaaaagtttatgtta
gatgttgtagctctttcgaaaatttaa

DBGET integrated database retrieval system