KEGG   Trichomonas vaginalis: TVAG_475320Help
Entry
TVAG_475320       CDS       T01022                                 

Definition
Clan CA, family C19, ubiquitin hydrolase-like cysteine peptidase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TVAG_475320
Peptidases [BR:tva01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TVAG_475320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1203 aa AA seqDB search
MTLYSATFKDTLDLSVFKQGELGEVEFKNDPISVKFIFQGDDDEGLYLVFSDFSDHPSDN
PYEIKLTLVAGEEFHKDFIQYINPQFEYSFELYYEDLQKYQEKYSSNLDFQIEIQELDKE
NCSTLPSERSYMFDYPADRIEKDFKYDFKYADYEFSFLLYLVSYGRVHLSFQLNNAGFSK
RLTVVYSLKVAGYHCKSAKMKFNSTTLTCDAEQISKSDWDELKKRATNGQIPFVIAIKRT
TESEEIEDEDDFMSLPNDTTSYSGHDNTYSYSNRSYYTPQTNYAVSTVSSKDETGFVGLH
NQGATCYLNSLLQTLYTLPAFRKVVYEMPTTGTEDEKKSIPLNLQRLFCQMQLRKEPCST
KELTTSFGWGSTETFMQHDAPEFNRVLLDNLEMKLKGTQLENSIADLFKGQYRKYIRCKN
YPYASTHDETFYELQMVVKDCPNLQKSFEKYIEKEILDGDNQYNVESHGKEDAEMGIEFV
KFPQVLQLHLTRFTYDFNYDRNVKLNDKFEFPEEIDLSPYLAEDADKSKSYVYQLHDVVV
HNGSATFGHYYAFIRPSAEDQWYKFNDSTVSKSTKESAIDDNFGGESETTTYSSSNYYNY
WGGGSSGKSYSAYMLMYMRKDAVQNIFEPIPDEAVPEHLKEYMNKKPSETYSSSLDLNSV
DITVTTEDDFEEGTLLMKKVFAQKDDPPKLEADNSISTQELYEKIANLLKIDVDEFRLWK
QSYYLLPQTLISRSETKKIDFTYSTAQVFVQKKSKEDPVEIPEDDIVVYTKFFFPFDQSN
NKVQYIGSFQINRESPLKNLIKMVNEKLGLPEDTELQVYAESIDKKAAILDNALTLDNLS
VNMGSVLIFQQNPEKEQILPSKFVKKSISDSQKGEESEVTDHTIPIIFAGDQSVAVTANK
YFIMYHEVLEYQFYDVHDCSKCIAILKFPTDILFTDLYKYIANSSLFDYDIDKDSILLYR
ANYSNEEKPSTDPIDTSYFTTPKTTLYSGQNKRLFFRVIKGTPQKDYANKLCRRIIYSSD
LSKIDIDDYFLFDKASDTVGKVVQELVSRGTIPDMEYDIIKMGYYSSMEGFLQLEETCSQ
YYNTVIRIQPKVADKSKFVFVEVGEFMNSMYYFSPSRNGICYLVDDAKTNEEILDDILAK
LQIQNNPKKFRLNFKAKEDPMAKNIQVSQFKDSLKNGASLYIVEKSKNSAKLSASNESIK
IYN
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgactctttattccgcaacttttaaagatacacttgacttatcagtgtttaaacaagga
gagttaggagaggtcgaatttaagaacgatcctatctcagtcaagtttatttttcaaggt
gatgatgatgaaggtttgtaccttgtcttttcagatttttctgatcatccaagtgacaac
ccatacgaaattaaactaactctcgtagcaggagaagaatttcataaagattttattcaa
tatatcaatccgcagtttgaatacagctttgaactctactatgaagatttacaaaaatat
caggagaaatattcatctaatttagacttccaaatcgaaatccaagagctagataaagaa
aattgcagcacattaccaagcgagagatcttatatgttcgattacccagctgacagaatt
gaaaaggatttcaaatacgattttaagtatgctgattacgaattctcatttcttctttac
ctagtttcttacggacgtgttcatttatcattccaactcaataatgcaggattttccaag
cgtcttaccgttgtttattcactcaaagtcgctggatatcactgcaagagcgcaaaaatg
aaatttaattcgacaactcttacatgcgatgcagaacagatctcaaagtccgattgggat
gaactaaagaagcgtgcaaccaacggacaaatcccatttgtcatcgcaatcaaacgcaca
acagaatccgaggaaattgaagacgaagacgacttcatgagcttgccaaacgataccact
tcatactccggccacgacaacacctattcttactcaaacagatcgtattacactccacaa
acgaattatgctgtttctacagtttcctccaaggacgaaaccggttttgttggtctccac
aaccaaggcgccacatgttacctgaactctctcctccaaactctctatactttgccagca
ttcagaaaagttgtctacgaaatgccaacaacaggcactgaggatgagaagaaatccatt
cctcttaacctacagcgcctcttctgccagatgcagctcagaaaagagccatgttccaca
aaggaattgacaacatctttcggatggggctctacagagacattcatgcagcacgatgca
ccagaattcaacagagtcctcttggataacctcgaaatgaagctaaaaggcacacaactc
gaaaattctatcgcagatctcttcaaaggccaatatcgcaaatacatcaggtgtaagaat
tatccatacgcttcaacacatgacgaaacattctacgaattacaaatggtcgttaaagat
tgtccgaatttacaaaaatctttcgaaaagtacatagagaaagagattttggatggagac
aatcaatacaacgtcgaaagccatggcaaggaagacgcagaaatgggtattgagttcgta
aaattcccacaagtccttcaactccatttgacacgttttacatacgattttaattacgac
agaaatgtaaaacttaacgataagttcgagttccccgaggaaattgacttatctccttat
ttggccgaagatgcggacaaatccaaatcgtacgtctaccagctccacgatgttgtcgtc
cacaacggatctgccaccttcggacactactacgccttcatcagaccttctgccgaagat
caatggtacaaattcaacgattcaactgtttccaagtcgaccaaggagtcagccattgac
gataacttcggtggagagtccgaaacaaccacttattcgtcctcaaactactataattac
tggggaggcggatccagcggcaaatcgtactccgcttacatgttaatgtacatgaggaag
gatgccgtgcagaatatcttcgagccaatccctgacgaagccgttccagagcatttgaaa
gaatatatgaacaaaaaaccatccgaaacctactccagttcacttgatttgaactctgtt
gatatcacagtcacaacagaagacgatttcgaggaaggaacccttttgatgaagaaagtt
ttcgcacaaaaggacgatccaccgaaattggaggctgataattcaatttccacccaggaa
ctctacgaaaagatcgcaaatctcctcaagatcgacgtagatgagttcagattgtggaaa
caatcttattatcttttgccacagacattaattagcagatccgagaccaagaagatcgat
ttcacatattcaacagcccaagtctttgtccagaagaaatccaaggaagatccagtcgaa
attccagaagatgacattgttgtttacaccaagttcttcttcccgttcgaccaatccaac
aacaaggtccaatacatcggcagtttccagataaaccgcgaatctccactcaaaaacctc
attaaaatggtcaatgaaaaacttggcctcccagaggacacagaactccaagtctacgcc
gaatccatcgacaagaaagccgcaattctcgacaacgcgctcactctcgacaatttgagc
gtaaacatgggttctgtcctcattttccagcaaaaccctgaaaaagaacaaattttgcca
agtaaatttgtcaaaaagtcaatttctgacagtcagaaaggcgaagaaagtgaagtgacc
gatcataccattcctattatctttgccggcgatcaatctgttgctgttactgcaaacaag
tatttcattatgtatcatgaagttttggagtatcaattttacgatgtacacgattgttcc
aagtgcattgcgatattgaaattcccaactgatatattgttcactgatctctacaagtac
attgccaattcatcgttgtttgactacgatattgacaaagacagcattcttttgtacaga
gcaaattattccaatgaagaaaaaccaagtacagatccaattgacacttcctacttcact
acaccgaaaacaactctttactccggccagaacaagagattgttcttcagagtaatcaag
ggaactccgcagaaggattacgcaaacaaactctgcagaagaattatttattcgtcagat
ttgtcaaaaattgacattgacgattatttcttatttgacaaggcatctgacactgttggc
aaagttgttcaagaacttgtttctagaggaacgattcctgacatggaatacgacattatt
aagatgggatactacagttccatggaaggattccttcaactggaagaaacatgttctcag
tactacaacacagtgattagaattcaaccgaaagttgctgataaatctaagtttgttttc
gtggaagtaggagagttcatgaactctatgtactacttcagtccatcgagaaatggaata
tgctacttggttgatgacgcaaagacaaatgaggaaattctcgatgacattttagcgaaa
ttgcaaattcaaaataatccgaaaaagttcagattgaatttcaaggcaaaggaagatcca
atggcaaagaacatccaggtgtcgcagttcaaggatagtttgaagaacggcgcatcttta
tacattgttgagaaatcaaagaactcagcaaaactctctgcttcaaatgaatctatcaaa
atctataattaa

DBGET integrated database retrieval system