KEGG   Trichomonas vaginalis: TVAG_479340Help
Entry
TVAG_479340       CDS       T01022                                 

Definition
EF hand family protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tva  Trichomonas vaginalis
Brite
Protein phosphatases and associated proteins [BR:tva01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     TVAG_479340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 190 aa AA seqDB search
MGIGQSAINKGYISENDAAKICESTYFTEKQINILATLFRKMTMKFHVDLETFCTTLNIE
NKEIGEILYNIVDSDGSGNINFIEFVQGLNIFHPAAPFKEKAKMCFQAYDRDGSGLVSKD
EILKVLKISLRNNDLIDFEDAKVDQLANQLDKEYSRNNTGELSYTEFYNMVQNAPGVIES
FDLDIDTLFG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgggaattggtcaaagcgccattaacaaaggatatattagtgaaaatgatgcagccaag
atctgtgagtcaacatatttcacggagaaacagataaacatactagcaacccttttcaga
aaaatgaccatgaaattccatgtagacttggagacattttgcacgacattgaatatagaa
aacaaagaaattggcgaaatactatacaacatcgttgactccgacggttccggaaatatc
aacttcatcgaatttgtacagggacttaatattttccaccccgccgcaccttttaaagaa
aaggccaagatgtgtttccaagcgtacgatcgagatggaagtggattggtctccaaagat
gaaatcttaaaggttcttaaaatttctctcaggaacaatgatttgattgactttgaggat
gctaaagttgatcagttagctaatcagttggacaaagaatattcgagaaacaatacaggc
gagttaagttatactgagttctacaacatggtacaaaatgctccaggagtaattgagagc
tttgacttagatattgatacattatttggttaa

DBGET integrated database retrieval system