KEGG   Trichomonas vaginalis: TVAG_484030Help
Entry
TVAG_484030       CDS       T01022                                 

Definition
glycosyl hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
tva  Trichomonas vaginalis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TVAG_484030
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    TVAG_484030
   00603 Glycosphingolipid biosynthesis - globo series
    TVAG_484030
   00604 Glycosphingolipid biosynthesis - ganglio series
    TVAG_484030
   00511 Other glycan degradation
    TVAG_484030
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TVAG_484030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 550 aa AA seqDB search
MRRARISLDIRDCIIPIIYGVIITLIIIKFVLSNPAIDPTSIIPHPYSVSFSAKIELFDL
TSSSVVCYDNTKPKLKTQAQFLVGYIFEQAGISVNLIGKISDDCSIIIDTGYQDSNEEAY
NLTITDYKIYINGSTSRGSFYGIQTLRKLIPTQKVYSVKFYQVEIIDRPRFSFRGLLLDV
SRYFQTFDNVKRFIDIMALHNMNYFHFHITDDQGWRFQSKKYPNLTLIGSMRNSTMKDGI
PRGGFYTQDELRKLVQYAADRQITIVPEIDLPGHSVSALAAYPDLGCTGGPYHVAQKFGP
QIDILCVGNPNTMTFIKDILTEVMEIFPSEYVHIGGDEVNKFHWRNCKKCQSRIRKLNLW
DDENSKEEYMQAYFTQELANFLASKGKKAIGWSEAAYVGKIGNLTVLSWLRHSAKGKSET
FGYPTILAPTKPFYLDYRQEFVDDSTYVIKGAPVNTLRDVYTYEPIEKFHKDEDIKNILG
IEACVWGEMTPNFERVMYQTLPRAAATAVAQWSEPVTKNYNSFVGSLNALTKIYDVNNWT
YFKKFRQVEY
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgagaagggcaagaatttcgcttgacattagagattgcataataccgatcatatatggt
gttattattactctaattataattaaatttgtcttatcaaacccagcaatcgatcctaca
tctattattccgcatccttattcagtatctttctctgcaaaaatagaattattcgatttg
acatcatcatcagtagtttgttatgacaatacaaaacctaaacttaaaactcaagctcaa
tttcttgttggttacattttcgaacaagcaggcatttctgtcaatctaattggaaaaata
tcggatgactgctctataataattgatactggttatcaagactccaatgaagaagcttat
aaccttacaattactgattataaaatttatattaacggaagtacaagcagaggatcattt
tatggcattcaaacgctaagaaaattgattccaactcaaaaagtatacagtgtcaaattc
tatcaagttgaaatcatcgatagaccgagattttctttcagaggacttcttttagatgtc
tcacgctatttccaaacattcgataatgtcaagagattcatagatatcatggctctccac
aatatgaactatttccattttcatatcacagatgaccaaggctggcgctttcaatcaaag
aaataccccaatcttacgcttattggctccatgaggaactccacaatgaaagatggaatt
cctcgcggtggattttacacacaagatgaactccgcaaacttgttcaatacgcagcagac
cgccagatcacaattgtaccagaaatcgacttaccaggccattccgtctctgctttggcc
gcctatcccgaccttggatgcacaggcggaccttatcatgttgcacaaaaatttggtcca
caaattgacattctttgtgtcggaaatccaaatacaatgacatttataaaggatattctc
acagaagttatggaaatcttcccttcagagtacgtccatatcggtggagatgaagtaaac
aaattccattggagaaattgtaaaaagtgtcaaagtcgtatacgaaaacttaatttgtgg
gatgatgagaacagcaaagaagaatacatgcaagcatatttcacccaggagctcgcaaac
ttcttagcatccaaaggaaagaaggcaatcgggtggtctgaagctgcttatgttggaaaa
attggaaatttgacggttttgagttggttgaggcattcagcgaaaggaaaatcagaaaca
ttcggatacccaacgattttggcaccaacaaaaccattctatcttgactacagacaggaa
ttcgtcgatgactccacttatgtcataaaaggagcacctgtaaacacattaagagatgtt
tacacttatgaaccaattgaaaaattccacaaagatgaagatataaagaatatccttggt
atagaggcttgtgtatggggagaaatgactccaaactttgagagggtcatgtaccaaaca
ttgccaagagctgctgccactgctgttgctcaatggagtgaacctgtaacaaagaattat
aactcttttgttggatctttgaatgctttaacaaagatttatgatgtcaacaattggact
tatttcaagaaatttagacaagtggagtattaa

DBGET integrated database retrieval system