KEGG   Trichomonas vaginalis: TVAG_494260Help
Entry
TVAG_494260       CDS       T01022                                 

Definition
Dolichyl-phosphate-mannose-protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tva  Trichomonas vaginalis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    TVAG_494260
Enzymes [BR:tva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     TVAG_494260
Glycosyltransferases [BR:tva01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   TVAG_494260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 485 aa AA seqDB search
MSSEFTFIDSVLVAIIAIVSLYVRLWTIERPSDVIFDEVHFGNFSKWYNTKYFHFDIHPP
LAKLIMAYIAKSAQYKGDIQRFYKLGIPYEKNETHYITQRYIPAIFSAGVAPLIYCSLRN
FAVSPICALLGSIMLALDSSMIVESKFILTDGILHFFTALHIFAFSLFLRTEDNFHVLLA
GITLGCASSCKFTALGLFALDGISQIFWILIKRPDIVAIISRATLLLAPAAFVFFFSFVL
HFALCPFAGKNAHYLEGPDKNTVFDFNKVNTSYWGNRLINSPLLLRTYRWIKVMHRINFR
SNIPHPWQSYPEYWPFMTDKQILFYSKESHRRITCTGLPASYWPSTAGVILVPFLFLIRF
ADWRDLLFTFGWAVSYFPFIMVPRTMFNYHYLIPLEFACANFGILIENVFSRRNSMRGFA
ATFFIITVILCYWFFCPIVYGTFAKDAINARRWLHQWNDGFKPALKYFNRVMYKTALMRT
QLPKY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgaatttacatttatagactccgtattagtcgctatcattgcaattgtgtct
ttgtatgttagattatggacaattgaaaggccttcagatgttattttcgatgaagttcat
tttggaaatttttcaaagtggtataatacaaaatattttcatttcgacattcaccctcct
ttagcaaaacttattatggcatacattgcaaaatctgcacaatacaaaggagatattcaa
agattttacaagctaggtataccatatgagaaaaatgaaacgcattacattacacagaga
tacataccagccatattttccgctggagttgccccattaatctattgttctcttagaaat
tttgcagtttctcctatttgtgctttattaggatcaataatgttagcactagattcatca
atgatagtagagtccaaatttatacttacagacggtattttacactttttcacggctctt
catatttttgctttttctttattccttcggactgaagacaattttcatgtactactagca
ggtatcacacttggctgcgcgtcatcctgcaaatttacagcgcttggcttatttgcttta
gatggaatttctcaaatcttttggattctcattaagcgaccagacatagtagcaatcata
agtagagccactctgcttctcgctcctgccgctttcgtctttttcttctcatttgtcctt
cattttgcattatgtccttttgcaggcaaaaacgcgcattatttggaaggtccagataag
aatacagtgtttgacttcaacaaagttaatacttcttattggggaaacagattaattaac
tctcctttacttttaaggacatatcgatggataaaggtcatgcataggatcaatttcaga
tcaaacatacctcatccttggcaatcgtatccagaatattggccatttatgacagataaa
caaattttattttattcaaaggaaagtcatcgaagaatcacatgtacaggacttcctgct
tcttactggccatctacagctggagttattctagttcctttcttgtttttgataagattt
gctgattggagagatttattattcacttttggatgggctgtatcgtatttcccatttatt
atggtacctagaacaatgttcaactaccattatttgattcctcttgaatttgcatgcgca
aatttcggaatattgattgaaaacgttttttcacggagaaattcaatgagaggattcgca
gctaccttctttataatcacagtaatactctgttattggttcttttgtccaattgtttac
ggaacttttgcaaaagatgctatcaacgcaaggagatggcttcatcaatggaatgatggc
tttaaaccagcgttgaagtactttaatcgcgttatgtacaaaactgcattgatgaggact
caacttccaaaatattag

DBGET integrated database retrieval system