KEGG   Trichomonas vaginalis: TVAG_497370Help
Entry
TVAG_497370       CDS       T01022                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tva  Trichomonas vaginalis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:tva01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tva01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tva00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tva00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tva00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 252 aa AA seqDB search
MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFIFLPTLQQKLRKDWKV
SAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGM
KIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQ
DAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPG
FINIVNSNVHSK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaacattctttgtcggaggcaactggaaggctaatccaaagacagtcgaagaggct
gagaagcttatcgaaatgctcaatggcgccaaggttgagggcaacgttgaagttgttgtt
gctgccccattcatcttcctcccaacactccagcagaaactccgcaaggactggaaggtc
agtgctgagaacgtcttcacaaagccaaacggtgctttcacaggtgaagttacagttcca
atgatcaagtcattcggcatcgagtggacaatcctcggccactccgagcgccgtgacatc
ctcaaggaagatgatgaattccttgctgccaaggccaagttcgcccttgagaacggcatg
aagatcatctactgctgcggtgagcacctttctgaacgcgaagccggcaaggcctccgag
ttcgtctctgctcagatcgagaagatgatcccagctatcccagccggcaagtgggacgat
gttgtcatcgcttacgaaccaatctgggctatcggcacaggcaaggttgcttccacacag
gatgctcaggaaatgtgcaaggttatccgtgacatccttgctgctaaggttggcgctgat
atcgctaacaaggtccgcattctctacggcggttccgtcaagccaaacaactgcaacgag
ctcgctgcctgcccagatgtcgatggcttcctcgttggtggtgcttccctcgaaccaggt
ttcatcaacattgtcaactccaatgtccactctaagtaa

DBGET integrated database retrieval system