KEGG   Trichomonas vaginalis: TVAG_516070Help
Entry
TVAG_516070       CDS       T01022                                 

Definition
Clathrin and VPS domain-containing protein
Orthology
K04646  
clathrin heavy chain
Organism
tva  Trichomonas vaginalis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tva00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    TVAG_516070
Exosome [BR:tva04147]
 Exosomal proteins
  Proteins found in most exosomes
   TVAG_516070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 342 aa AA seqDB search
MAVLRACIEIGDFKLAQVAGLQIVIEADHLLEVIKLYEDGGYFTQVIGLLEAALGLERAH
GGIFTELAVLYAKHQPEKCMDHLKQFNQRIALFKVIKILQAMHMWKELTYAYDKYSEFDN
AVTTIIEHPSAAWTHNYFKELVAQVSNADILYRSLNFYLTISPMDIPDLLQTIGPKIDST
RLVDMFKRSNNLQLIKSYLASIQSTNVQAVNEALNRMYIEDGDYDSLRRSIDAFTLFEQI
TLARELEHHECLEFRRISSYIFRKNQRWNESISISKKDEFYRDAIETAAQSKDTKIAEDL
IKFFLEKKLLECFAAATYVCYDLLSSDVILELAWRHNCTDFA
NT seq 1025 nt NT seq  +upstreamnt  +downstreamnt
atggctgtactccgcgcttgcatcgaaatcggagacttcaagctcgcccaggtcgctggc
ttacagatcgtcatcgaagccgatcaccttcttgaggtcatcaagttgtacgaagacggt
ggctacttcacacaggtcattggcttacttgaagcagctctcggcttagagcgcgcacac
ggcggcatcttcacagagcttgccgttctctacgccaagcaccagccagagaagtgcatg
gaccacctcaagcagttcaaccagcgcatcgcccttttcaaggtcatcaagatcctccag
gccatgcacatgtggaaggaactcacatacgcctacgacaagtattccgagttcgacaac
gccgtcacaacaatcatcgagcacccatctgctgcatggacacacaactacttcaaggaa
ctcgtcgctcaggtctccaacgcagatatcctctacagatcactcaacttctacctcaca
atctctccaatggatatcccagacttgttgcagacaatcggtccaaagattgactcaaca
agacttgtcgacatgttcaagcgctccaacaacctccagctcatcaagtcatacctcgct
tccatccagtccacaaacgtccaggctgtcaacgaggccctcaacagaatgtacatcgag
gacggcgactacgactcactcagacgctcaatcgatgcattcacactcttcgaacagatc
acattggcacgcgagttagagcaccacgaatgcttggaattccgcagaatctcatcctac
atcttcagaaagaaccagagatggaacgagtctatctccatctccaagaaggacgagttc
tacagagatgcaatcgagacagctgctcagtccaaggacacaaagatcgccgaagatctc
atcaagttcttcctcgagaagaagctcctcgagtgcttcgccgctgccacatacgtctgc
tacgacctcctctcatccgatgtcatccttgaactcgcatggagacacaactgcacagac
ttcgc

DBGET integrated database retrieval system