KEGG   Trichomonas vaginalis: TVAG_558650Help
Entry
TVAG_558650       CDS       T01022                                 

Definition
Clathrin and VPS domain-containing protein
Orthology
K04646  
clathrin heavy chain
Organism
tva  Trichomonas vaginalis
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:tva04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 413 aa AA seqDB search
YEDGGYFTQVIGLLEAALGLERAHGGIFTELAVLYAKHQPEKCMDHLKQFNQRIALFKVI
KILQAMHMWKELTYAYDKYSEFDNAVTTIIEHPSAAWTHNYFKELVAQVSNADILYRSLN
FYLTISPMDIPDLLQTIGPKIDSTRLVDMFKRSNNLQLIKSYLASIQSTNVQAVNEALNR
MYIEDGDYDSLRRSIDAFTLFEQITLARELEHHECLEFRRISSYIFRKNQRWNESISISK
KDEFYRDAIETAAQSKDTKIAEDLIKFFLEKKLLECFAAATYVCYDLLSSDVILELAWRH
NCTDFAMPFLIQSMRDQNAAIAKLQADVQALSGTVEETKTVAAAAASASVAPPAFDGGFP
DQGASFAQSTDPFAASGAPASFAPPQQFGNASFGGQPGFASQGGFQPQFQGGF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
tacgaagacggtggctacttcacacaggtcattggcttacttgaagcagctctcggctta
gagcgcgcacacggcggcatcttcacagagcttgccgttctctacgccaagcaccagcca
gagaagtgcatggaccacctcaagcagttcaaccagcgcatcgcccttttcaaggtcatc
aagatcctccaggccatgcacatgtggaaggaactcacatacgcctacgacaagtattcc
gagttcgacaacgccgtcacaacaatcatcgagcacccatctgctgcatggacacacaac
tacttcaaggaactcgtcgctcaggtctccaacgcagatatcctctacagatcactcaac
ttctacctcacaatctctccaatggatatcccagacttgttgcagacaatcggtccaaag
attgactcaacaagacttgtcgacatgttcaagcgctccaacaacctccagctcatcaag
tcatacctcgcttccatccagtccacaaacgtccaggctgtcaacgaggccctcaacaga
atgtacatcgaggacggcgactacgactcactcagacgctcaatcgatgcattcacactc
ttcgaacagatcacattggcacgcgagttagagcaccacgaatgcttggaattccgcaga
atctcatcctacatcttcagaaagaaccagagatggaacgagtctatctccatctccaag
aaggacgagttctacagagatgcaatcgagacagctgctcagtccaaggacacaaagatc
gccgaagatctcatcaagttcttcctcgagaagaagctcctcgagtgcttcgccgctgcc
acatacgtctgctacgacctcctctcatccgatgtcatccttgaactcgcatggagacac
aactgcacagacttcgcaatgccattcctcatccagtcaatgagagaccagaacgctgcc
atcgccaagctccaggctgatgtccaggctctctctggcacagtcgaggagacaaagaca
gtcgctgctgcagctgcttctgcatctgtcgctccaccagcattcgacggcggattccca
gaccagggcgcttcattcgctcagtcaactgatccattcgctgcttccggtgctccagct
tcattcgccccaccacaacagttcggaaacgcttcattcggtggccagccaggattcgct
tcacagggtggattccaaccacagttccagggtggattctaa

DBGET integrated database retrieval system