KEGG   Trichomonas vaginalis: TVAG_569160Help
Entry
TVAG_569160       CDS       T01022                                 

Definition
(RefSeq) hypothetical protein
  KO
K10739  
replication factor A2
Organism
tva  Trichomonas vaginalis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:tva00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TVAG_569160
   03420 Nucleotide excision repair
    TVAG_569160
   03430 Mismatch repair
    TVAG_569160
   03440 Homologous recombination
    TVAG_569160
DNA replication proteins [BR:tva03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    TVAG_569160
DNA repair and recombination proteins [BR:tva03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     TVAG_569160
   MMR (mismatch exicision repair)
     TVAG_569160
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     TVAG_569160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 175 aa AA seqDB search
STISIDYLVNDCTGSIKVKNFISDDNPEPIPDGTYVFVVGRITPAIEDGISSFTIKPITE
FDQIPYHMLYSLFVHLQTTRGTPPDSSFAQAPKHVETSAPAPPPMRSSEDRDEKIKNDVI
EFLKENNSDRGTPEEQIIQHFSHIYSAEEVKKAVETANFNGEIYSTSEDNCYNPC
NT seq 530 nt NT seq  +upstreamnt  +downstreamnt
atagcacaatcagtattgattacttggtgaatgattgtacaggcagtatcaaagttaaga
atttcatttcagatgataatccagagccaattccagatggaacatacgtttttgttgttg
gacgaattacacctgctattgaagatggaatatcttcattcacaatcaaacccataacag
aattcgatcaaattccttatcatatgctttactcattgttcgtacacttacagacaacaa
gaggaacacccccagactcctctttcgctcaagcaccaaagcatgttgaaacatccgctc
cagcacctcctccaatgcgatcaagcgaagacagagatgaaaagattaagaacgatgtca
ttgaattcctcaaagagaacaattcagatcgcggaactccagaagaacaaattattcaac
atttctcacacatatactcggcagaagaagttaagaaagcagttgaaacagcaaacttta
atggtgaaatctactctacaagcgaagataattgttataatccttgctaa

DBGET integrated database retrieval system