KEGG   Trichophyton verrucosum: TRV_00114Help
Entry
TRV_00114         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
tve  Trichophyton verrucosum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRV_00114
Enzymes [BR:tve01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     TRV_00114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 314 aa AA seqDB search
MERSKKPTAIPVSSSAPGPSVSVLENRVEASLATGESITVNLFGATVTSWKLADGSEQLF
LSEGAHLDGSKPIRGGIPLVFPSKVFGPPPKEHATSALPQHGFARNAYWEFLGKSTSETE
GDASVKLDFGLSKGMLSDKFQKDWPFEFGLVYSVTLSPRSLITSLQVQNKGTTSFEFQSL
LHTYFRVDDISKMCIAGLQSKSFVDKLRGASTFTEESDAITISSEVDRVYQSLDPATPVI
VTSSGKPVFSITREALTDMVVWNPWIEKAKGMADITPDEAYKNMVCVEAGSVSGWQTLEP
GDMWEGGQTIRCRL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttcaaagaagccgacagccatccccgtatcctcctccgcaccaggacccagc
gtctccgtcctcgagaaccgcgttgaagcatcgctggcaaccggagaatcgattactgtc
aacctgtttggagctacagtgacgtcgtggaaactcgccgacgggtcagagcagcttttc
ctcagcgaaggagctcatctagacggctccaagcccatccgcggcggcatccccttagtc
ttcccaagcaaggtgtttggccctcctccaaaggaacatgcaacatctgcactgccgcag
catggcttcgcccgcaacgcctactgggaatttctaggcaaatccacctcggaaaccgaa
ggagatgccagtgtcaagcttgactttggcctgtcaaagggtatgctgagtgacaagttc
cagaaggactggccgttcgagtttggcctagtgtacagtgtcaccctaagcccccggagc
ttgatcacttcgctgcaggtccagaacaagggaacgacctcctttgagttccagtctctg
ctgcatacttacttcagagtagatgacatctcaaagatgtgcattgcaggtcttcagtcc
aagtcgtttgtcgacaaactccgcggtgcatccacgttcactgaagagtccgacgccatt
accatctcctccgaggtagaccgcgtctaccagtctcttgaccccgccacgcctgtcata
gtcacctcctcgggcaagccggtcttctccataacccgggaagcgttgacggacatggtc
gtctggaacccgtggatcgagaaggccaaggggatggccgatatcaccccggacgaagcc
tacaagaacatggtctgcgtcgaggcgggatctgtatctggatggcagactctggagcca
ggtgacatgtgggaaggagggcagacgattcggtgtcggctgtga

DBGET integrated database retrieval system