KEGG   Trichophyton verrucosum: TRV_00119Help
Entry
TRV_00119         CDS       T01615                                 

Definition
lysophospholipase Plb2
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
tve  Trichophyton verrucosum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TRV_00119
Enzymes [BR:tve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TRV_00119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 654 aa AA seqDB search
MMFIPATLGTFVLASLLPATVGAGIPNAAADVAVRALPNAPDGYAPAEVDCPSTKPAVRS
AAKLSQQEQDWLKKRRMKTTGAMADFFSRVKIEGFDAVAYLVGNADNVAKLPNVAIAVSG
GGYRALIIGAGALKAFDSRTDNSTEPGQLGGLLQSATYLSGLSGGGWLLGSMYVNNDSTI
TELQKGGSNSLWKFNRSILEGPDDGSSGVVDTAEYYKEMIKEISRKKAAGFETSITDIWF
FIDNANVVYRGRALSYQLINAPKGGPAYTWSSISQNSKFQSGDVPFPLLVADGRNPGEKL
IGGNATIFEFNPYEFGTWDPTIFGFVPTQYIGSKFEAGTLPSDEKCVRGMDNAGFIMGTS
SSLFNQFALHLDSQDLPKVVKDSLRDFLSSLDEANNDIAEYKPNPFFGYAKSTSPFAGVK
SLPVVDGGEDKQNIPFHPLIQPARHVDVIFAIDSSADTELAWPNGDSIIATYQRSLNSTG
IANGTSFPAIPDNNTFINLGLNHNPTFFGCDSSNTTNPTPLIVYIPNSPYVTHSNVSTFN
LKYNTTQRDAIILNGYNVATMANATRDGNWPTCVGCAMLSRSLERTKTAVPDACKQCFKM
YCWDGTLNSTKPDVYDPKLFLTEVDLQSAAKGLHASGKLSLVAAVVTLLSILLV
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgatgttcatcccagcaacgctgggaacatttgtcctagcaagcttgcttcctgcgacc
gttggagccggcatacctaatgccgccgcagatgttgcagtcagagctctgccaaatgcg
ccagacggctatgcccctgcagaagtcgactgtccatctaccaaaccggctgttcgatcg
gctgcaaagctgtcgcagcaggaacaggactggctgaagaaaaggaggatgaagaccacg
ggcgctatggcagacttctttagtcgcgtgaagatcgaaggctttgacgccgtggcatac
ctcgtaggcaacgcagacaatgttgctaagctcccaaacgttgccattgccgtttcagga
ggcgggtaccgtgctctcattattggagctggtgccctcaaggcatttgatagtcggacg
gataattcgactgagcctggacagctgggtggcttgctgcagtcagctacttacctgtcc
ggtctcagtggtggtggatggctacttggctcaatgtacgtcaacaatgacagtactatc
acggaattgcaaaagggaggcagtaattcgctgtggaagtttaaccggtccattctcgag
ggaccagatgatggtagctctggggtcgttgacaccgctgagtactataaggagatgatc
aaggagatttctcgcaagaaagccgctggcttcgagacctctatcactgatatctggttc
ttcattgataatgctaacgttgtatataggggcagagcattgtcgtatcagctcattaac
gctcccaagggtggtccggcctatacatggtcgtccatctcacagaattccaagttccag
agtggcgatgtgcccttccctcttctcgttgccgatggcaggaatccgggtgaaaaactc
atcggcggtaatgctaccatcttcgaattcaatccatacgaatttggtacatgggatccc
actatcttcggttttgttccaacacagtacattggctccaagttcgaggctggaaccctt
ccatcggatgagaagtgcgtccggggaatggacaacgccggtttcatcatgggaacttct
tcctctctattcaaccagttcgcgttgcaccttgatagccaggacctgcccaaagtcgtc
aaggacagtctccgtgacttcttgagctcgcttgatgaagccaacaatgacattgccgag
tacaagcccaacccattttttggatatgccaaaagcacatctcctttcgcaggagtaaag
tccctccccgttgttgatggcggtgaagacaagcagaacattccattccatcccctgatc
cagccagctcgacatgttgacgttatatttgcgattgactcttccgctgacaccgaactg
gcctggcctaatggcgacagcataatagctacttaccaacgcagtctgaacagcactgga
atcgccaacggaacatccttcccagctataccagataataacactttcatcaatctcggc
ctgaaccacaatcccactttcttcggatgcgacagctcaaataccactaatcctacgccg
ttgatcgtatacatccctaacagtccctacgtcacacattcgaatgtctcaactttcaac
ctgaagtacaacaccacacagcgtgatgctatcattctcaatggatataacgtcgcaacc
atggccaatgccactcgagatggcaactggcctacctgcgtcggctgtgctatgctcagc
aggtcccttgagcgaaccaagaccgcagtccccgatgcttgcaagcagtgttttaagatg
tactgctgggatggaacgctcaatagcaccaagccagacgtctacgacccgaaactgttc
ttgacggaagtggacctacagagtgctgctaaggggcttcatgcttcgggaaagctgagc
cttgtagcagcagtggtcacactgctttctatattactggtgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system