KEGG   Trichophyton verrucosum: TRV_00272Help
Entry
TRV_00272         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tve  Trichophyton verrucosum
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:tve00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TRV_00272
  Replication and repair
   03420 Nucleotide excision repair
    TRV_00272
Transcription machinery [BR:tve03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TRV_00272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 386 aa AA seqDB search
MVTEPFSTSLRQALMGEDQQGSFGVISVTPDKYPVSVADLDEYARQQWEAVLGYMVGMSS
LSGGRETITLSKGVKQLLQACHLVEVRDRRVEITKEGFAFVLQDVNTQVWHILILYVENA
EAIGMESVEVLSFVFLLSSLELGQSYEKKDLTPTQLRTLADLTDFGIVYQHTPASGSTRF
YPTRLATTLTSDSLAMSGPISGEPAVPTTTAGTTTSGDAGTGFIIVETNYRLYAYTSSPL
QISLISLFTTLKFRFPNLITGKITRQSVRRAIEMGITADQIISYLTTHAHPQMRKTKKST
SNVSSSVLPPTVVDQIRLWQLERDRIKATSGFLFKEFDTFAEFEAPCKYAEEIGVLVWKS
DSRRMFFVTRHEQVAAFLRSRAASRG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccgaaccgttttccacttctttgcggcaagctctcatgggagaagaccaacag
ggctcgtttggagttatatcagtgactcccgacaagtatccggtctccgtcgcggattta
gacgaatatgcaagacagcaatgggaggctgtgcttgggtacatggttgggatgagctcg
ttaagcggaggacgggaaaccatcactctcagcaaaggggtgaagcagcttcttcaggcc
tgccatctggtggaagtccgagatcggagagttgaaattacgaaagaaggattcgccttt
gttctacaagacgtcaatacccaggtctggcatatactcatcctctacgtcgagaacgca
gaggctatagggatggaaagcgtcgaggttctctcgttcgttttcttgcttagtagcctt
gagctcggccagtcttatgagaaaaaggacctcactcccacacagcttcgaacacttgcc
gatctcactgattttggcattgtctaccaacatacgcctgcttctgggtccacccgattc
taccctacccggctggctactacacttacttctgactctttggccatgtcaggcccaata
tcaggagaacctgcggtcccgaccacaactgcaggtactacaacgtccggtgatgcaggc
accggattcattattgttgaaacaaactaccgtttatacgcatacacatcatcacctcta
cagatatctctcatctccctctttaccactctaaaattccgatttccgaatcttattacc
ggcaaaataacccgtcaatccgtccgccgagccattgaaatgggtatcacggctgatcag
attatatcgtatctcaccactcatgcccatccacagatgcgtaagacgaaaaaatctacg
tcaaacgtttcttcttcggtcttgccacctactgttgtcgaccaaatacggctttggcag
ctggaacgagatcgaatcaaagcaacatcaggatttcttttcaaggagttcgacaccttt
gcggaattcgaagctccttgcaagtatgccgaagaaatcggtgtcttggtttggaaatct
gattcaaggaggatgttttttgttaccagacatgaacaggttgctgcgttcctacgtagc
agagcggcgtcaaggggttaa

DBGET integrated database retrieval system