KEGG   Trichophyton verrucosum: TRV_00396Help
Entry
TRV_00396         CDS       T01615                                 

Definition
checkpoint protein kinase, putative
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
tve  Trichophyton verrucosum
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:tve00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    TRV_00396
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     TRV_00396
Protein kinases [BR:tve01001]
 Serine/threonine protein kinases: Other group
  TTK family
   TRV_00396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 823 aa AA seqDB search
MASPTPLPTGHRRFVPSSRVASHPSYETGSQWNYNSEHPSILQSRTDTKSRAAHADTIAL
GDSSDDEAPEPIAFSKSVLAILTDSLPKEKRNGASILQKDSSSRKWDGNSPRGSETSSSS
RKGESQGGASSATSTSRNDGSDLITPAPRQRVVRVPRSRSSNQTPSPRASPDREYRTKHD
ESQYESHSPLRHRTHASKDHAGVSGERAGPRSMFRPRKSDEVVGMQSSIRVKRVGKLTGE
FLNGPARRGMLPRRSEERQCFENEEQAGDSDAERGERLQGHSPSLAALENSVGRKHSPAG
LDQRQPSPVEIHTPPHQPPYHDGSYNRESKPKAPRVSSPVYPTPGLGVMSRSNPKESVPP
ADIQSYHIPPPSQFPANREQENEPPPTFKKSKAQHFDMLDRVDKPAIKQDLYRHSHKSTP
QDPDRKPLGSMSTNVPTPHRAPPPPPKMTVLETATAAAGAASSSSSRRKKAIVTVNHKAY
TRLDCIGRGGSSRVYRVMAENCKIFALKRVNLEHVDPTNLAGYKGEIDLLKKLEKVERVV
RLLDYEINEEKETLSVLMEMGESDLHTVIRLKVNAEDSVFDPAFARFYWKEMLECVQAVH
EYDIVHADLKPANFLLVKGKLKLIDFGIADTIEDHTVNVHREHQVGTPNYMAPEAIIDYN
ATIGLPSSAGKIMKIGKPSDVWSLSCILYQMAYGRAPFGHLAKQMERVLCIANPKVAIEY
PSTGVGGAVIPPSLIRTLKKCLQRDPTLRPTTTQLLDRSDPFIYPPAYPEGAVPVTQEAL
GMAMTKIVSHCRLHGIPKDEEVIGWSAGLFQKLQASAEQGYNS
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccgaccccgttgccgacgggccaccgcagatttgttcccagttcacgcgtc
gcatcccacccaagctacgagacaggatcgcaatggaactacaattcagaacacccgagc
atactacaatcgaggacagacacgaaatctcgcgcggcgcatgcagataccatcgcgctt
ggcgatagttcagatgacgaggctccagaacccattgcctttagcaagtctgttctcgct
atcctcacggactccctacccaaggaaaagaggaatggagcctcaatactacaaaaagat
tcgtccagcaggaaatgggacgggaattcacctcgcggtagtgaaacctcatcatcttcg
cgaaaaggcgaaagccaaggaggcgcctccagtgctacgagtactagcagaaacgatgga
agcgaccttattaccccagctcctcgacagcgcgtggtccgcgtaccacggtctcggtca
agcaatcaaaccccgtccccaagagcttcacctgatcgtgagtacaggaccaaacatgat
gagagtcaatacgaatcgcactctcctctaaggcataggactcatgcatccaaggatcat
gccggtgtttctggcgagagggcagggccacgaagcatgttcagaccaaggaaaagtgac
gaggttgtgggaatgcaaagctcgattcgggtgaagcgtgtggggaagctgaccggtgaa
tttttgaatggccctgcccgcagaggaatgctacctcgacgcagcgaagagcgacagtgc
ttcgagaacgaggaacaagcaggagattcagatgctgaaaggggagaaagactgcaagga
cacagcccttcattagcagccttggaaaactctgtaggcagaaaacactcgcctgccgga
ttggatcagcgacaaccttctccagtggaaatccatactccacctcatcaaccgccttac
cacgatgggtcgtataacagggaaagcaagccaaaagctccccgtgtatcgagccctgta
tacccaaccccaggtcttggggtgatgtcaaggtcaaacccaaaggagtcagtgcctccc
gctgacattcagtcgtatcatattcctccaccatcccaatttcctgcaaatcgtgaacaa
gaaaatgagccaccaccaactttcaagaaatccaaagcccaacattttgacatgcttgat
agagtcgacaagccagccattaaacaagatctgtaccggcattcacataagtccacgccg
caggatcctgatagaaaaccactaggaagcatgagcaccaatgtcccaactcctcataga
gcacctcctcctcccccaaagatgactgtgcttgaaacggctacagcagcagcaggggca
gcgtcctcgtcgagctctcgacgcaagaaagcaatagtgactgtcaatcataaggcgtat
acccgactagactgtattggtcggggtggaagctcgcgagtgtatagagttatggcagaa
aattgcaaaatatttgctctgaagagggtaaatctagaacatgtcgatccaacgaacctt
gcaggatacaagggcgagattgatttgctcaaaaagctggagaaggtcgaacgagtagta
cgactacttgattatgagataaacgaagaaaaggagacacttagcgtcctcatggaaatg
ggagaatccgacctccacactgtgataagactgaaagtaaatgcggaggactcggtcttt
gacccggcatttgcacggttttattggaaggaaatgctggaatgtgtgcaggcagtacac
gagtatgacattgtccacgccgatttgaaaccagcaaacttcctcttggtgaaagggaag
ctaaaattgattgattttggcattgctgataccatcgaggatcacaccgtcaacgtccac
agagaacatcaagttggtaccccgaattatatggcccccgaggccatcattgactacaat
gctaccattggtcttccatcctccgctggtaagataatgaaaatcggaaagcccagtgat
gtatggagcctgagctgtatcttataccaaatggcatacggccgcgccccctttggccat
ctggcaaaacaaatggaacgcgtcctatgtattgccaacccgaaagtggcgattgaatac
ccttctactggagttggtggtgcagtcattccacccagcctcatccgcactctcaagaag
tgccttcaaagagatcctaccctccgcccaaccacaacgcagcttttggataggtcagat
ccttttatatatccacccgcttaccccgagggcgctgtgcccgtcactcaggaagctctt
ggaatggcaatgacgaagatagtcagtcattgccgcttacatggcatcccaaaggacgaa
gaagtaattggatggtctgccgggctcttccagaagctgcaggcctcagctgaacaggga
tacaattcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system