KEGG   Trichophyton verrucosum: TRV_00465Help
Entry
TRV_00465         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
tve  Trichophyton verrucosum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 673 aa AA seqDB search
MSTPSTATATHPSHQRYGYSRHQVYHQPNPQSFPTASAASNALANSFSYTSNHQSTTNGL
SLASTPKTTAPVPSMASYSTPTVLPTAHSRRKQPDWGEFYKNGVPKEIIVIDDDDDDDNT
NNDPVPVSASAVTSSTRTAPRVAPSASSSNLPANKKRRTDASSGVDVYYERPAYSASSQK
YGEGSSAAPSMSTDRTASIHTTAPTSLGSQASGSAANNAYLDDVAVGQKRKRVVTRKAAR
DELKRRELETVGDAFSSYIPPPKPPIKAKDVVVPVIRDYNANKNQKIDDEDGHYIVNPDT
NLTDKFHSPRLDSIIRLLGQGTFGKVVEAYDRQRKTRCAVKIIRSVQKYRDASRIELRVL
STLASNDETNRNRCIHLRDCFDFRNHICIVTDLLGQSVFDFLKANSFVPFPSSQIQNFAR
QLFTSVAFLHDVNLIHTDLKPENILLVSNAYQTFTYNRTIPSSSHTTSRTARQRRVLLDS
EIRLIDFGSATFDDEYHSSVVSTRHYRAPEIILNLGWSFPCDIWSIGCILVEFFTGDALF
QTHDNLEHLAMMESVCGGKIDPKLVRQVLQGRNGHGANSAAKYFNRTKLDYPNEDTSRAS
RKYVKAMKQLHEFIPATTSFNKQFLDLLRRIFVYDPKVRITAKEALKHPWFKDTIIDDGT
EAVRIRQEQQRGA
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccccttctactgctacggcaacccatccatctcaccagcgttacggatactct
cgtcatcaagtataccaccagcctaacccgcagtcgttccccaccgcgtcagcggcgagc
aatgcgcttgcaaactcgttcagctacacgtccaaccatcagtcgaccaccaacgggctt
tcgctagcatccacgcccaaaacgaccgctccagtgccttccatggcctcctacagcacg
cccacagtcctcccgactgcccacagccggcggaaacagccggactggggagagttttat
aagaacggcgtccccaaggagataattgttattgacgacgacgatgatgacgataataca
aacaacgatcctgtgcccgtctctgcttcggcggtgacctcatccaccagaactgcaccc
cgtgttgccccttctgcctcttcttccaacctgccggcaaacaagaaacgaaggaccgac
gccagttcaggcgtcgacgtctactacgaacgccctgcctactctgcctcctcccaaaag
tacggcgagggctcgtctgcggcgccttcaatgtcgaccgaccgcaccgcctctattcat
accaccgctcccacctcacttggctcgcaggctagcggttctgcagccaacaacgcctac
cttgatgatgtcgctgtcggccagaagcggaagcgagtcgtgacacgtaaggctgcacgt
gatgaattgaaacgaagagaactcgagaccgtcggcgatgcattcagcagctatattcct
cctccaaagccgcccatcaaggccaaagatgtcgttgtccccgtcatccgtgattacaac
gcgaataaaaaccagaagatcgacgatgaagatggacattacatcgtcaacccggacacc
aatctcaccgacaaatttcattccccccggctagactcaattatccgccttctgggccaa
ggcacatttggcaaggttgtggaggcatatgatagacaaagaaagactcgctgtgcagtg
aagatcatcagatcggtccagaaataccgcgatgcctctcggatcgaacttcgagtcctc
tcaactctcgcatccaacgacgagactaatagaaaccggtgtatccatcttcgggactgt
ttcgatttcagaaaccatatctgcatcgtcaccgacttgctgggccagagcgtgtttgat
ttcctaaaagcaaactccttcgtcccattcccgagcagccagatccaaaacttcgctaga
caactcttcaccagcgttgcctttctacacgatgtcaaccttatacacaccgatttgaaa
cctgaaaatattcttctcgtcagcaatgcttaccagacgtttacatataaccgaaccatc
ccatcttcctctcacacaacctcgaggactgctcggcaacgacgtgtcctgctcgacagc
gagattcgtctaatagacttcggttctgcgactttcgacgatgaataccattcctccgtg
gtttcgactcggcattatcgtgcccctgagattattctcaatcttggatggagcttcccc
tgcgatatctggagtataggctgtatcttggtcgagttcttcaccggagatgccctcttc
cagacacacgacaacctcgagcacctcgccatgatggagagcgtttgtggtggtaaaata
gacccaaaacttgtcagacaagttctacaaggccgtaacggacacggtgccaattctgct
gctaaatatttcaaccgcaccaaacttgactatccaaatgaagatacctccagagcgtca
agaaaatacgtaaaagcaatgaaacaacttcacgaatttattcctgcaacaacttccttt
aacaaacaattccttgacctgcttcgccgcatcttcgtctatgaccccaaagttcgcatt
actgccaaagaggccctcaagcacccatggttcaaggatactatcatcgatgatggtact
gaggcagtccgtatccgccaggagcagcagcgtggggcctga

DBGET integrated database retrieval system