KEGG   Trichophyton verrucosum: TRV_00493Help
Entry
TRV_00493         CDS       T01615                                 

Definition
ubiquitin C-terminal hydrolase Ubp8, putative
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
tve  Trichophyton verrucosum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 489 aa AA seqDB search
MATLSTPLYEPAYGCGKCSFLRRKLKACILTYFRTEHLKDIFEKDTDAATRLAENYTKLS
SKGPWNLSQIRLDASKKSSSGPKFSLKPQYQCLQCSVVVADYRSKHVFCQGCNDLIYDID
LESILKNSTEPIVSRKRKVDNLEDDEYANYIAMNTNKKICGKEGVRGLFNLGQTCYMNVI
LQTLFHEPVLTAYFLGNGHSTSECQKANCFGCALADAFAEFSNEEKDEGFGALNLLLASW
QTSADLAGYHQQDAHEFYQFLVNQLHESTTGNLDCDPACRCFFHTAFFGKLRSTITCRNC
GKVSRTEDPVMDVSLDLQVQKKKRALDGGDQSSDVAPTLQGCLEGYISPEKLAASEYGCT
QCNSNMGVTKQLRLRKLPVILCMQLKRFERNRSVSEKVETKVTYPASINMMPYTTSPRSE
NRSQFQYDLLSVVVHIGDIDSGHYLAYCRHGEQWFKFNDDRVTVVAESEVLGADAYLLFY
TLQAYGVSK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggctactctgtccactcctctttatgagccagcttatggctgtggtaagtgttcgttc
cttcgtaggaagctcaaagcatgcattttgacctactttcgcacagaacacctcaaggat
atatttgagaaagacacagacgcagccaccagactcgctgagaactacaccaaactgagt
agcaagggaccatggaacttatcacaaattcgtctagatgcctcgaaaaagagtagctct
gggccaaagttctccctgaaaccgcaataccagtgcctccaatgctcggttgtcgttgcc
gactacagaagcaagcatgtcttctgccaaggatgtaacgacctcatctacgatatcgac
ttggaaagcattctgaagaatagcactgagcctattgtctccagaaaacgcaaggtcgat
aatttggaagatgatgagtacgcgaattatatcgccatgaataccaacaaaaaaatttgc
ggcaaagaaggtgtcagaggactgttcaacctcggtcagacctgttacatgaatgttatt
ctccagaccctattccacgaaccggtcttaacggcctacttccttgggaatgggcatagc
acgagcgagtgccagaaagcgaactgtttcggctgtgctctcgcagatgcttttgctgag
ttcagcaacgaagaaaaagacgagggcttcggtgccctcaacctcctccttgcctcgtgg
caaacatccgccgacctcgccggttaccaccagcaagacgcccacgaattttaccagttc
ttggtaaaccaacttcacgagagcaccacagggaatctcgactgtgaccccgcctgtcgc
tgcttcttccacaccgcattcttcggcaagctacgaagcaccataacctgtcgcaactgt
ggcaaggtttcccgcaccgaagacccagtgatggacgtcagccttgaccttcaggtccaa
aagaagaagcgtgcccttgacggcggagatcagagctccgacgttgcgccaaccctccag
gggtgcttggaagggtatatctcccctgaaaagcttgcagccagcgaatatggatgcacc
caatgtaactccaacatgggagttaccaagcaacttcgactacgaaagttgccagtcatc
ctctgcatgcaactgaagagattcgagcgcaatcgatctgtctccgaaaaggtcgaaacc
aaagtcacataccctgcctcgatcaatatgatgccctacaccaccagccctagatcagag
aaccggtcacagttccaatacgacctcttgagcgtcgttgtccacatcggcgatatcgac
tctggccactaccttgcttactgccggcacggtgaacagtggttcaaattcaatgatgac
cgtgtaactgttgttgctgagtcggaggttcttggggcagatgcctaccttctcttctac
accttgcaggcatatggtgttagcaagtag

DBGET integrated database retrieval system