KEGG   Trichophyton verrucosum: TRV_00493Help
Entry
TRV_00493         CDS       T01615                                 

Definition
ubiquitin C-terminal hydrolase Ubp8, putative
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TRV_00493
Peptidases [BR:tve01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TRV_00493
Transcription machinery [BR:tve03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     TRV_00493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 489 aa AA seqDB search
MATLSTPLYEPAYGCGKCSFLRRKLKACILTYFRTEHLKDIFEKDTDAATRLAENYTKLS
SKGPWNLSQIRLDASKKSSSGPKFSLKPQYQCLQCSVVVADYRSKHVFCQGCNDLIYDID
LESILKNSTEPIVSRKRKVDNLEDDEYANYIAMNTNKKICGKEGVRGLFNLGQTCYMNVI
LQTLFHEPVLTAYFLGNGHSTSECQKANCFGCALADAFAEFSNEEKDEGFGALNLLLASW
QTSADLAGYHQQDAHEFYQFLVNQLHESTTGNLDCDPACRCFFHTAFFGKLRSTITCRNC
GKVSRTEDPVMDVSLDLQVQKKKRALDGGDQSSDVAPTLQGCLEGYISPEKLAASEYGCT
QCNSNMGVTKQLRLRKLPVILCMQLKRFERNRSVSEKVETKVTYPASINMMPYTTSPRSE
NRSQFQYDLLSVVVHIGDIDSGHYLAYCRHGEQWFKFNDDRVTVVAESEVLGADAYLLFY
TLQAYGVSK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggctactctgtccactcctctttatgagccagcttatggctgtggtaagtgttcgttc
cttcgtaggaagctcaaagcatgcattttgacctactttcgcacagaacacctcaaggat
atatttgagaaagacacagacgcagccaccagactcgctgagaactacaccaaactgagt
agcaagggaccatggaacttatcacaaattcgtctagatgcctcgaaaaagagtagctct
gggccaaagttctccctgaaaccgcaataccagtgcctccaatgctcggttgtcgttgcc
gactacagaagcaagcatgtcttctgccaaggatgtaacgacctcatctacgatatcgac
ttggaaagcattctgaagaatagcactgagcctattgtctccagaaaacgcaaggtcgat
aatttggaagatgatgagtacgcgaattatatcgccatgaataccaacaaaaaaatttgc
ggcaaagaaggtgtcagaggactgttcaacctcggtcagacctgttacatgaatgttatt
ctccagaccctattccacgaaccggtcttaacggcctacttccttgggaatgggcatagc
acgagcgagtgccagaaagcgaactgtttcggctgtgctctcgcagatgcttttgctgag
ttcagcaacgaagaaaaagacgagggcttcggtgccctcaacctcctccttgcctcgtgg
caaacatccgccgacctcgccggttaccaccagcaagacgcccacgaattttaccagttc
ttggtaaaccaacttcacgagagcaccacagggaatctcgactgtgaccccgcctgtcgc
tgcttcttccacaccgcattcttcggcaagctacgaagcaccataacctgtcgcaactgt
ggcaaggtttcccgcaccgaagacccagtgatggacgtcagccttgaccttcaggtccaa
aagaagaagcgtgcccttgacggcggagatcagagctccgacgttgcgccaaccctccag
gggtgcttggaagggtatatctcccctgaaaagcttgcagccagcgaatatggatgcacc
caatgtaactccaacatgggagttaccaagcaacttcgactacgaaagttgccagtcatc
ctctgcatgcaactgaagagattcgagcgcaatcgatctgtctccgaaaaggtcgaaacc
aaagtcacataccctgcctcgatcaatatgatgccctacaccaccagccctagatcagag
aaccggtcacagttccaatacgacctcttgagcgtcgttgtccacatcggcgatatcgac
tctggccactaccttgcttactgccggcacggtgaacagtggttcaaattcaatgatgac
cgtgtaactgttgttgctgagtcggaggttcttggggcagatgcctaccttctcttctac
accttgcaggcatatggtgttagcaagtag

DBGET integrated database retrieval system