KEGG   Trichophyton verrucosum: TRV_00542Help
Entry
TRV_00542         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tve  Trichophyton verrucosum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TRV_00542
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TRV_00542
Enzymes [BR:tve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     TRV_00542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 546 aa AA seqDB search
MSFVEQEEQKFLQDVEQVKNWWKDSRWRYTKRPFTAEQIVAKRGTLTIDYPSNAQSKKLW
KILEGRFASTPLTLVKNKDASFTYGCLEPTMLTQMVKYLDTVYVSGWQSSSTASSTDEPS
PDLADYPMNTVPNKVNQLFLAQLFHDRKQREERLRAPKEQRNSLPNIDYLRPIIADADTG
HGGLTAVMKLTKLFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQAD
IMGTDLLAIARTDSEAATLITSTIDPRDHAFIVGSTNSSIEPLNDLMVAAEQAGKNGAEL
QQIEDEWTSKAGLKRFQDAAIEQINASPSISNKKAAIDTFLADIKGKSNSEARAIAKQLT
GSDIYWNWDSPRTREGFYRYQGGCECAINRAVAYGPFADLIWMESKLPDYAQAKEFAEGV
HAVWPEQKLAYNLSPSFNWKTAMPRDEQETYIRRLGELGYSWQFITLAGLHTTALISDQF
AKAYAKQGMRAYGEMVQEPEMDNKVDVVTHQKWSGANYVDELLKMVTGGISSTSAMGKGV
TEEQFK
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgttgaacaagaggaacagaagttcctgcaagacgttgaacaagtcaagaac
tggtggaaagattcaagatggcgatacaccaaacgtccattcaccgcagagcaaattgtt
gccaaaaggggtaccttgacaattgattacccatcaaatgcacagagcaagaagttgtgg
aagatcctggaaggtagatttgcgtcaaccccgctaactctcgtgaagaacaaagatgca
agttttacttatggttgcctggaaccaaccatgctcacccagatggtgaaatatttagac
actgtctatgtttctggttggcagagctcatcaactgcctcctcaactgatgagccttct
cccgaccttgctgactacccaatgaatactgtgccgaacaaggtcaaccagcttttccta
gctcaactgttccatgacagaaaacagagagaggaacgtctccgcgcccccaaggaacag
cgcaacagcctaccgaacattgattatctccgtccgattattgctgacgcagacactggc
catggtggtctgaccgctgtcatgaagctcacaaaactatttattgagcgcggggctgct
ggaatccatattgaggatcaagcccctggtacgaagaagtgcggacatatggctggaaag
gttcttgtcccaatcagtgagcatatcaaccgacttgtagccatccgagctcaagctgat
atcatggggactgaccttctggctattgcgcgaaccgactccgaggcggcaaccttaatt
actagcactattgatccccgggatcatgctttcattgttggatccaccaactctagcatt
gagcctcttaatgatctgatggttgctgcagagcaggcgggcaagaacggtgccgagctt
caacaaattgaggacgagtggaccagcaaggctgggttgaaacgtttccaagacgcagcc
attgagcaaataaatgcttccccttccatctctaacaaaaaggctgctattgacacattc
cttgctgatataaagggaaagagcaactctgaagcgcgtgctattgccaaacagttgact
ggttctgatatctactggaattgggattcgccacgaactagagaaggattttacagatac
caaggtggatgcgagtgtgccattaaccgtgccgttgcatatggcccattcgctgatctc
atttggatggagagcaaacttcctgactacgcgcaagccaaagaattcgccgaaggtgta
catgctgtctggcccgagcagaaacttgcatacaacctctcgccttccttcaactggaag
acagctatgccccgcgacgagcaagagacttatatccgtcgtctgggagagcttggctac
agctggcagttcatcacccttgctggtctacacaccactgccctgatatctgaccaattt
gccaaggcatacgctaagcaagggatgcgtgcatacggagagatggttcaggagccggag
atggataacaaggtcgacgttgtcacccaccagaaatggagtggtgcaaattacgtggat
gaactattaaagatggttaccggtggcatcagtagcactagtgccatgggtaagggcgtt
actgaggagcagttcaagtag

DBGET integrated database retrieval system