KEGG   Trichophyton verrucosum: TRV_00553Help
Entry
TRV_00553         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K12743  
N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase [EC:6.3.2.26]
Organism
tve  Trichophyton verrucosum
Pathway
Penicillin and cephalosporin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Penicillin biosynthesis, aminoadipate + cycteine + valine => penicillin
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    TRV_00553
Enzymes [BR:tve01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.26  N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase
     TRV_00553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 3765 aa AA seqDB search
MTIENDIKRPSNDAITLENGKALNFRKQIPSTHERMYCNGSLDKWRLCISHISERCDLSG
LAKACTKYQLALTGFSDVNTHRERQTVTVDVPEEVNTALRDRYIRQGGSLRSIVLFAVHQ
MLRGFGNGSHTVTASISPDSEHRLSWEVSPTIVSHKNRGQTSVLEAIRNIDISNQRLQSS
KNEEIEEETQPNRASRFEEVGSELEGGWMKSELFDLPVVFVKARLDHVMRLSSIDVDFPL
AVLVHEGHNDGDLQLAVQFSTSLFAPETIQNFTDALKILLAEASTGPGTLVKDIDLLSAQ
QIQQLDVWNNTDGDYESSKRLNHLVEDAARHCPDKELLYLCHFVQPEQLIGLFLEKNELL
IITILAIWKSGAAYVPIDPAFPDDRVRFVLDDTKANLLIASDAHAARLQKNITSNKDIQV
IRLELLLKELTSSAAGEFHDGQNLDHLPLNSRQLAYVTYTSGTTGFPKGIFKEHTSVVNS
ITDLSVKYGVAGSHHETILLFSAYVFEPFVRQLLMALVNGHLLAIISDVKKYDSDYLLSL
MQRHQVTYLNGTASVLQEYDFSTCPSLKRIILVGENLTAARYDSLRERFKGTILNEYGFT
ESAFVSALNIFKPHSKRENTSLGRPVRNVKCYILNQELKRTPIGVTGELHIGGLGISRGY
LNRPDLTPFKFIPNPFQTGREKELGINRLMYKTGDLARWLPNGEVEYLGRADFQIKLRGI
RIEPGEIESTLSMYPNIRTSLVVSRKLRSGGEETANEHLVGYYVCQNNVEVVPEESLLAF
LETKLPRYMIPSRLVHLEYIPVNINGKADLKALPMVDLSRTAKGALNNLGHQTEIDLQKI
WSDVLGIGNDSISPEDSFFRLGGHSISCIQLIARIRQQFSVIISVEDVFSMKTLSRMAAF
LRKRQSEIEASCTTDIATLSRASLSFPVLSGSNSTCYLANSLQQGFIYHYLKNKEPSGTY
IMQSLLRYDTELRPDVFQKAWKLTQHAFPALRLRFLWEKDVFQIIDQDQPLHFRFFSSDR
DLEGLSREDKLQNLQKQDLREDYKLDAGELFRVYMIKHDDQHFSSLFSCHHAILDGWSLP
LLFQHVHEEYLRLIKGGHFHFDTHIDKAYGHSQNFLQMNRDTHLEYWSGVVDQITERCDM
NVLLNEQSRYKIPLANYDQVRDQRQQTLHLDCDMHLRNIHDACSERGITLHSILQFIWHT
ILHKYGGGSHTVTGTTISGRNLPVEGIEHSVGLYINTLPLVLDHTEYKNKSVLDAMSDVQ
AKVNAMNTRGHVELGRLYKSNLKHGLFDTLFVFESYPALDRVKELHHQEALHYSIQGNME
KLNYPLTAIVQDINAATIDTLTFTICYASELFDTPTILELLSMVQDTIKQISSNLTRPAN
SLEYLSLAQVNQLAEWNATEADFPDATLHQQFELEVDRVPSKTAIIYEDVTLTYHELNER
ANRMAWQLKREVDIKPDDLVALVLDKSEHMMVSILAVWKSGGAYVPIDPSYPEDRISYIL
QDTNAVTVIADPIYIPKVEKLTRPGVPIYPSDLATHNTSDWSSDNPPPSSISTSLAYIFY
TSGTTGRPKGVMVEHHGVVNLQTSLSRIFGLRETDDEVIFSFSNYVFDHFVEQMTDALLN
GQTLLVLNDTMRGDKERLYQYMEKNRVTYLSGTPSVISMYEFSRFKAHLRRVDCIGEAFS
EPVFDQIRETFQGLIINGYGPTEVSITTHKRLYPFPERRTDKSIGCQIANSTSYVLDEDM
KRVPIGAVGELYLGGDGVARGYHNRPDLTADRFPLNPFQTDKEKSEGRNMRLYKTGDLVR
WIPGSRGEVEYLGRNDFQVKIRGVRIELGEVEAVLSSYPEVKQSVVVPKKRAQGGQTFLV
GYCVSGSTISSIDIKRFMQSRLPDYMVPSRLIFVTKLPVTPSGKLDTKALPAVDESTENE
VVAPRTEIERTLREIWAELLEIPLEDISIYSDFFGLGGDSLKSTRLSFMVNEFLHRTISV
AELFQHRTIEALGRLIVNGIGDIQDIALITDTNKDISISPAQERVLFLHELEGGNSKGYN
ITKTLKLSSQTSPSLIEQALRELLSRHEALRTLLQKDAVSGIYHQKILNNNEAQSLFFIN
TSTVRDLDHLDQKISDASQHIFHLGEELPLRVYMFTENDVSLYLTFVIHHSNFDGWSWNI
VFRELVMLYSRLQGKDSITLPKLTVQYKEFAHHHRHILIGDRFRVLSEFWRSKLENFEPL
HLNTDKSRPPHFEYDGDDVNFIIGEPEVKELQKVARQCKASLYAVLLALYGLMLASYTHQ
TNIPVGVPVTHRTHPQFESVVGFFVNLLVVRVDVTRQGIVGLVKRVIRELVDAQLHQDMP
FQEVTKLLNTEHDPSRHPLVQTVFNYESNQADTLRTKENKGGFAEYQPKQTYSAAKFDLS
ATVSEMGSKVMVNFNYAISLFTKSTIMGMLDTHRHLIYGVCRLTERRINDTMQLPLMPTC
QGDGSHLPLLETQLAIPRDKEPVATLNKLFEAEVALASDCVAIVEGEKTITYGDLNVQAN
QLAWYLLSITDLKPDDHVALMLDKSISMLICILAVWKAGAAYVPLDPTFPDNRIGTTLQE
SKPKAVILHSKYAARFESQGMSLITIDTTENISHQSTDDVKSNVQPENLAYSIFTSGTTG
KPKGVSVKQNGVINLRNGLRMRYFGNCAPGNHSVLFLSNYIFDFSLEQIALSILSGQTLI
IPPEHSFASNEFYDICNSYKLSYLSGTPSLLQQIDLRKLKFLKMVTAAGEELHASQYKKM
RDSFHGTIHNAYGVTETTVYNLITAFSANDGFENCLREVLPGNRIYLLSHNLQPVPLNAV
GQLYLTGDCLARGYLNQPTLTTQRFIPNPFRTDEDAASGKFSHLYKTGDLARCRLDSSGN
PYIEYMGRNDLQVKLRGLRIELSEVQRVMSSVPGVEDCAVIAKYMDDNPRSRVAQYLVGY
YSTENPSGLEEIIIRHMKTKLPGYMIPDHLCYLRGPFPVTRTGKLDTQKLPDIDVTTGPR
AVYSPPRNALQSKLCALWASVLGVERCGIDDDLFKMGGDSITSLHLVAQIHHRLSCKVTV
RDLFEHRTIRKLYNNVLHNDLSGSTSEFRTEQGLVTGEAPLLPIQEWFLSKPLEKRDRWN
HTFYIQTPELDVDRLSVAVQKLQDYHDAFRLRLKQKGETFVLSFPTEHQKIALRLLDVSS
ICERAAVNEALSEWQSGFNIENGPIGIIGYLYGYSDKTARVWFSIHHLAIDTVSWQILIR
DLRNLYLDENLGSKGSSLRLWANSMSSYQGSKLEREYWDNLIAQSSQSVAALPPSTGPRL
KLGRVMGADKSASLLQHAGQMEASVLAAVGLALQDVEPMCCNMVTLEGHGREEGIDSTLD
VSRTMGWFTSMYPFQIPHVKEANMLAAVAEIKAEVDGVPCHGAGYGALYGYVRHPLPSVS
VNYLGQLTRTSHMPDYDWNLAIGDGEYAYGLTCSPEDAKKSSSAIDITVTCIDGRVAVDV
LSIWDQDKSEVLISTIERGLDHITEQLSSGSTSSTESPSCQLFTEETFTPYFEYRDPSHR
QGPTLFLLPPGEGGAESYFNNIVKYLPKHSLVAFNNFYLHSKALQTFEELAEWYTDHIRR
LQPHGPYHLLGWSFGGILAMEIARRLDDGSGKVIGSLLFIDTYFDVRGATEEIGMAEKTI
LDKIHHVYDPEPARLAHMLSRVKDVVLFKAAKPNDKYTSDEQRLLYEYYHRTRANNLDKF
IPIEHVSVMPLQGNTHFSWVQDVEQVKKVCSVIENILDNMENGHT
NT seq 11298 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgaaaacgacatcaaacgaccaagtaatgatgctatcaccttggaaaatggc
aaagctctgaattttcgaaagcagataccctcgacccatgagaggatgtactgcaatggg
agcctcgataaatggaggctctgtatcagccatattagtgaacgctgtgatcttagtggc
cttgcaaaggcctgcactaaataccagctagcactaacagggttttccgacgttaatact
catcgggagcgtcaaactgtaaccgttgatgtccccgaggaggttaacaccgccctcagg
gacagatatatccggcagggaggctctcttcggagcatcgtgctgtttgcagtgcatcag
atgcttagggggttcggcaatggttcccacacagtcactgcttccatcagcccagattcg
gaacaccggctttcttgggaggtatcccctaccattgtctctcacaaaaatcgcggacaa
acgtcagtcctcgaggccatcagaaacatcgacatcagcaatcagcggctacagtcttcc
aaaaacgaagaaatcgaagaagaaacacagccgaatcgggcatcgaggttcgaggaagtc
ggtagtgaactggagggaggctggatgaagtcggagctcttcgacttgccggttgtcttc
gttaaggcgcgcttagatcacgtgatgcggctctccagcatcgacgtcgatttcccacta
gccgtgctcgtccatgaagggcacaacgatggagacctccagctggctgtccagttttct
acatcactctttgcgcctgagacgatacaaaattttactgatgcgttgaaaatcctgctc
gcggaggcctcgacaggcccagggaccctagtaaaggacatcgacctgctctcggcgcag
caaattcagcaactggatgtttggaacaataccgatggagattacgagtcttctaagcgc
ctcaaccatcttgtagaagatgcggcacggcactgcccggacaaagagctgttatatctc
tgccacttcgtgcagccagagcaactcatcggcctatttctcgagaagaacgagctgctt
ataatcacaatcctcgcgatttggaagtcgggagctgcttatgttccaatcgaccctgct
ttccctgatgaccgtgtccgttttgttctggatgatacaaaggctaatctcctcatcgcc
agcgatgcacatgctgcaagattgcaaaaaaacattaccagcaataaagatattcaagta
atcaggcttgagctacttctgaaagagttaacatcttcggcggccggtgagttccatgat
ggacaaaatctggaccacctgcctcttaacagcaggcagcttgcatacgtgacatatacc
tctggcactaccggcttcccaaaaggaatattcaaagaacatactagtgtggtgaatagt
atcacggatttgtctgtcaagtacggtgtggcagggtcgcatcatgagacgattttgcta
ttttctgcttatgtatttgaaccgtttgtccgccaactgctcatggcgttggtgaacggc
catcttctcgccattataagtgacgtgaaaaaatatgattccgactacctgctatccctc
atgcagcggcaccaggttacctacctcaacggcaccgcgtctgtgttgcaggagtacgac
ttctccacatgtccatcattgaagcgtataatcctcgtgggtgagaatctgacggccgca
cgatatgactcacttcgcgagagatttaaggggacaattttgaacgaatatggatttacc
gagtcagcttttgtgtctgccctgaacatatttaagcctcattccaaacgagaaaatacc
agtctcggacgcccggttaggaatgtaaagtgttatattctcaaccaggagctaaagcga
actcctattggagtaacgggtgaattgcatatcggcgggttgggtatttcacgagggtat
ttgaaccgccccgacctgaccccgttcaaatttatccccaatcctttccagacgggaaga
gagaaagagctcggtatcaatcgcttaatgtacaaaactggtgacttggccagatggcta
cccaacggcgaggtggaatatcttggacgcgcggatttccagatcaaattacgcggcatc
cgaatcgagccgggagagatcgaatcgacgctttctatgtatcccaacatccgaacaagc
ctggtagtgtctagaaaactcagatcaggaggtgaagagactgccaacgaacatttagta
gggtactatgtgtgccaaaataatgtggaagtggttcctgaggagagtctgttggcattt
ctagaaacaaagctacccagatacatgatcccatcacgtctggtccacctcgaatatatt
cctgtgaatattaacggtaaagctgacctgaaagccttacccatggttgatttatcaagg
acagcgaagggtgccttaaataatttgggacaccaaacggaaattgacctacaaaagatt
tggagtgatgttctcggtatcgggaatgattccatatcacctgaggatagtttctttcgc
ttaggagggcatagtatcagttgtattcagctgattgcacggatccgacaacagttttct
gtcatcatttctgtggaggacgtcttttcaatgaaaacccttagccgcatggctgcattc
ctacgcaaaaggcagagcgaaatcgaggctagctgtacaactgatattgctacactatca
agggcctctctaagttttcctgtcctttcggggagtaacagcacttgttaccttgccaat
agtcttcagcaaggttttatataccactacctaaaaaataaggagccttctggaacatac
attatgcaatctcttttgcggtatgatactgaattgcggcctgatgtttttcagaaggcc
tggaaacttacgcaacatgcatttccagcactgaggctccgatttttgtgggagaaggac
gtatttcaaattattgaccaagatcagcctcttcatttccgattcttctcttctgatagg
gatctggagggcttatctagagaggataagcttcagaatctacaaaaacaagatctgcgg
gaagattacaagctagatgctggggaactctttcgggtgtacatgataaagcatgatgac
caacatttttcctccctctttagctgccatcatgctattctcgatgggtggagcctgcct
ttactcttccagcatgtccatgaggagtatctccgccttatcaaaggcggacactttcat
tttgatacccatattgataaagcgtacggacacagtcagaactttcttcaaatgaatcgt
gatactcaccttgaatactggtctggtgtagttgatcaaatcacggaacgctgcgatatg
aatgtccttctgaatgagcagagtagatacaagatacctctcgcaaactacgatcaggtc
cgagatcagcgccagcagaccttacatcttgattgcgatatgcacctgagaaatatccac
gatgcatgctctgagcggggaatcactttacactctatccttcagttcatctggcacacc
attctccacaagtatggtggcggaagccatacagttacgggaacaacaatctctggccgc
aatctacctgtcgaaggcattgaacactctgtcggactctatataaacaccctaccctta
gtcctagatcacactgagtacaaaaataagagcgtcctggatgcaatgtctgatgttcag
gccaaggtcaacgcaatgaatacacgggggcatgttgagctgggccgtttgtataaaagt
aacctgaaacacggactctttgacactctgtttgtctttgaaagctatccagccttggat
agggtgaaagaactccatcatcaagaagctttacattattccattcaaggaaatatggaa
aaattgaactatcctctcacggctatagtgcaggatatcaacgctgctaccatagacacg
ctcacatttaccatctgctatgccagtgaacttttcgatacacccacgatcctagagtta
ttgtcaatggtacaagataccattaagcagatatcaagcaaccttacccgaccagcaaat
agcttggagtatctctctttagctcaggtcaatcaattggctgagtggaatgcaactgaa
gccgacttcccagatgcaactcttcatcagcagttcgagttggaggtagacagggttcct
agtaaaactgctatcatctatgaggacgtaacgttaacataccatgaattgaacgagaga
gcgaatcggatggcctggcaattgaagagggaggttgacataaaacccgatgacctagtc
gctctcgttctggataaaagcgaacacatgatggtttctatattggcagtgtggaagtct
ggtggagcttatgtaccgatcgacccgtcataccccgaagaccgcatttcttatatcctc
caggacactaacgcggtcactgtgattgccgaccccatctatatccccaaggttgagaaa
cttacacggccaggagtaccgatatatccatcagatttggctacacataacactagcgat
tggagctcagataaccctcccccttcaagcataagcacgagcttagcctacatcttctat
acatctggaacgactggccggccaaaaggggtaatggtagaacatcacggagtggtcaat
ctccagacttcgctctccaggatctttggcctccgtgagactgatgacgaggttattttc
tccttctcgaactatgtctttgatcattttgtagagcagatgaccgatgctttgctgaat
ggtcagactctattagtcctgaacgataccatgcgtggagataaagaaaggctctatcaa
tacatggagaaaaatagggtaacttacttgtctggaaccccgtcagttatatccatgtat
gaatttagccggttcaaagcgcacttaagacgagtcgattgcattggtgaggcgtttagc
gaaccagtttttgatcagattcgcgaaaccttccaagggcttatcatcaatggctacggt
cccactgaagtctctattactacccacaaacgtctatatcctttcccagagcgccgcact
gataagagtatcggctgtcagatagccaacagcaccagctacgttctcgatgaagacatg
aagcgcgtcccaatcggggccgtcggagagctctacttaggtggtgatggcgttgcccga
ggttatcataatcgccccgaccttacagccgatcgatttcctctcaatccattccagaca
gacaaagagaaaagtgaggggcgcaatatgcgactctataagactggggatcttgtgcgt
tggattcctggaagtagaggagaggttgaatacttgggtcgcaatgactttcaagtaaag
attcgtggagtgcgaattgaactcggcgaagtcgaagccgttctgtcttcgtatccagaa
gtcaaacagtccgtggttgttcctaaaaaacgtgcgcaggggggccaaacattccttgtt
ggatactgtgtttctggttcaacaatatcttccatagatataaaacgatttatgcaatct
cgtctgccagactacatggttccctctcggctcatcttcgtcacaaagttacctgttacc
cctagtggcaaactagatacaaaagctctgccagccgttgacgagtcgacagaaaacgaa
gtagttgcaccacggactgaaatcgaacgaactttgcgtgaaatatgggcggagttactt
gaaataccgctagaggatatcagcatctacagcgatttctttggcttgggaggcgatagt
ctgaagagtaccagattatccttcatggtcaatgaatttcttcacaggacaattagcgtc
gccgagcttttccaacatcgaacaatcgaagcattaggtcgtttaatcgttaacggcatc
ggggacatacaggacatcgccttgatcactgacacaaacaaggatatctcaatatccccg
gcgcaagagcgtgttttatttctccacgagcttgaaggcgggaatagtaaagggtacaat
ataacaaaaacattaaaattgtcctcccagacgagcccttctttaattgaacaggcgcta
agggaacttctatcacgacatgaagcattacgtactttgctgcagaaggacgctgtctct
ggaatctaccatcagaagattttgaataataatgaagcgcagtctttgttcttcatcaac
acatctacagtcagggatttggatcatctcgatcaaaaaatttctgacgcttcccaacat
atattccatctgggagaggaactacccctcagggtgtatatgttcacagagaatgatgtt
tcattatatctcacgtttgtcattcaccactcgaactttgatggttggtcttggaatatt
gtcttccgggaacttgttatgctttattctcgtttgcaaggcaaagactctatcacactt
ccaaaactcaccgttcaatataaggagttcgcgcatcatcatcgtcatatacttataggc
gaccgttttcgcgtactctccgagttctggcgaagtaagcttgagaacttcgagcccctt
cacctcaatactgataaatctcgaccaccccattttgaatatgatggagatgatgtgaac
tttattataggcgaaccggaggttaaagagttgcaaaaggtggccaggcaatgcaaagca
agtctctacgctgttctccttgcattatacggtctcatgctcgcttcctatacccatcaa
actaatattccggtcggtgtacctgtcacccatcgaacccacccacagttcgaatctgtt
gttggttttttcgtcaatcttcttgttgtacgagtggatgtgacccgtcaaggaattgtt
ggacttgttaaacgggtaatacgggagctggtggatgctcaacttcatcaagacatgccg
ttccaggaggtaacaaaacttctgaatacagaacatgaccccagtcgacatcctctagta
caaactgtattcaattatgaatcaaaccaggctgataccctacgaacaaaagagaacaaa
ggaggtttcgctgaataccaaccaaaacagacatactcggctgcaaaatttgacttgagc
gctacagtttctgaaatgggatccaaggtgatggtcaactttaactacgctatcagtcta
ttcaccaaatccacaattatgggaatgctggatacacataggcatcttatctatggtgtt
tgtcgtttaaccgaacgcaggattaacgacactatgcaactcccattgatgcccacatgt
cagggtgatggcagtcacttgccattgctggagacacagcttgccatccccagggacaag
gagcctgttgctacattgaacaagctgtttgaagccgaagttgctctggcgtcagactgt
gtcgcgatcgtcgaaggagagaaaaccatcacatatggcgatctcaatgtccaagctaac
caattggcatggtatttactttcaataacagacttgaaaccagatgaccatgtagctctg
atgctggacaagagtatcagcatgctcatttgtattcttgctgtttggaaagctggagcg
gcatatgtaccccttgatcctacatttcctgataacagaataggcacaaccctccaggaa
tccaagccaaaagctgttattttgcatagcaaatacgcagcacggttcgagtcccaaggt
atgagcctcatcacaatagataccacggagaacatcagccaccaatccacagatgatgtc
aaatcaaatgtgcagcctgaaaatctggcatacagtatattcacatcaggaactactggc
aaacctaaaggtgtatcagtcaagcaaaatggggttatcaatcttcggaacggccttcga
atgcgatattttggcaactgtgcgccaggaaaccatagtgtgctatttctctccaactac
atctttgacttctccctcgaacaaatagcgttatcaatcttgagtggccagacactgatc
atcccgccagaacattctttcgccagcaacgagttctatgatatctgcaattcatataaa
ctctcttatttgagcggaactccgtctcttttgcaacaaatcgatttacgaaaactaaag
tttctgaaaatggtaacagctgctggtgaagagctccatgcctctcagtacaagaagatg
cgtgatagcttccacggtactattcacaacgcttatggagtcactgaaacaacagtatac
aatctcattactgccttttcagccaatgatgggtttgaaaactgtctacgagaagtctta
cctggaaatcggatttacctactcagccataatcttcagcctgttccgctaaatgcagta
ggacaactatacctgacaggtgactgtctcgctcgtgggtacctcaaccagcccacatta
accacacagcggtttatccctaaccccttccgcactgatgaggacgctgcctctggaaaa
ttctctcacttgtataagactggagacctagctaggtgcaggctggatagctcagggaat
ccttatatcgaatacatgggacgaaatgacctccaagtcaagcttcgaggtctccgaatt
gagctttccgaagttcagcgagttatgtcctcagttcctggggttgaagactgcgctgtc
atcgcgaaatatatggatgacaacccacgctctcgtgtggctcagtatcttgtgggatac
tactccacggaaaatccatcaggccttgaggaaataatcattagacatatgaaaaccaag
ctacccgggtatatgatacctgaccatctgtgctatctcagaggcccctttcccgttact
agaacggggaagcttgatacccaaaagctaccagatatagacgtcacgaccggcccccgg
gccgtttattcaccaccacgcaatgccctgcaatccaaactttgtgctctctgggcctct
gtcttgggggtggaacggtgtggaattgatgatgacctgttcaaaatgggtggggacagc
atcacctcccttcatctggtcgcgcaaatccatcatcgccttagttgcaaggtcaccgtt
cgtgacttattcgaacatcgaaccatccggaagctatacaataatgttctacataatgat
ctgtcaggctcaaccagcgagttccgtactgagcaaggtcttgtcacgggtgaggcaccc
ctactgccaattcaagaatggttcctttccaagccgctagagaaacgggatcggtggaac
catacattctacatccaaactccagaattggatgtggatcgtttatcagttgctgtacag
aagttacaggactatcacgatgcattccgtctgcgattgaagcaaaagggggagactttc
gttctatcattcccgacagagcatcagaaaattgcactccgcctcttggatgtaagcagc
atttgtgaacgtgctgctgtcaatgaggccctcagcgagtggcagtcggggttcaatatt
gagaatggccctatcggtattattggctacttgtatggctacagtgataaaacagcccgt
gtatggttctcaatccatcaccttgccatcgatacggttagctggcagattttgatacgc
gatcttcggaatttatatcttgatgaaaatttaggcagcaagggcagcagtcttcggcta
tgggctaacagtatgagcagctatcagggctcaaaactggagcgagaatactgggataac
ttgatcgctcaaagttcccaaagtgttgcagcactccccccttctactgggcctcgtcta
aaattagggcgtgtcatgggtgctgacaagtcagcatctctgctgcagcacgctggccaa
atggaagcatctgtgcttgctgcagtcgggctagcgctccaggatgttgagccaatgtgc
tgtaatatggtcaccttggaaggacatggccgtgaagaaggtatcgatagcactctggat
gttagccgtacgatgggctggttcacaagcatgtatccatttcagattccccatgtgaag
gaggccaacatgcttgcagcagtagccgagatcaaggcggaggtggacggagttccttgc
catggcgctggatatggtgcgctctatggctatgtacggcatccattacccagtgtcagc
gtcaattacctagggcagcttacgcgaacgtcacacatgcccgattatgactggaattta
gctattggggatggagaatacgcatacgggctgacgtgtagccctgaggacgcaaaaaag
agctcttccgctatagacataacggtgacatgcatcgatgggagagtggctgttgacgtt
ctcagtatctgggaccaagacaagagtgaggtgttgatatctacgattgagcgcggactg
gaccatatcaccgagcagctcagcagtgggagtacatcttcaaccgagtctccgtcctgc
cagttatttaccgaagaaacattcacgccttactttgaatatcgtgaccctagccatcga
caaggtccgaccctgtttctcctacctccaggcgaaggcggagccgagagctacttcaac
aacattgtcaaataccttccaaagcacagtctggtggctttcaacaatttctacctacac
agtaaggctctacagacattcgaggagctggcggagtggtatacggaccatatacggcgt
cttcagcctcacggaccgtaccatttacttggctggagttttggcggcatcctcgcgatg
gaaattgcccgccggctagatgatggcagtgggaaggtgattggctcacttctattcatt
gacacctacttcgacgtccggggcgcaaccgaggagatcgggatggctgagaagacaatc
ctggacaagatccatcatgtatatgatcctgaacccgcgcggcttgcacatatgctctcc
cgagttaaagatgttgttctcttcaaggctgccaaacctaacgacaaatataccagcgac
gagcagcgtctattatacgagtactatcataggaccagagccaacaacttggacaaattc
atccctatcgagcatgtctcggtaatgcctttgcaaggtaacacccatttttcctgggtc
caggatgttgagcaagtgaagaaagtatgcagcgtgattgaaaacatactggataacatg
gagaacggacatacttag

DBGET integrated database retrieval system