KEGG   Trichophyton verrucosum: TRV_00602Help
Entry
TRV_00602         CDS       T01615                                 

Definition
(RefSeq) DNA polymerase delta subunit 4, putative
  KO
K03505  DNA polymerase delta subunit 4
Organism
tve  Trichophyton verrucosum
Pathway
tve00230  Purine metabolism
tve00240  Pyrimidine metabolism
tve01100  Metabolic pathways
tve03030  DNA replication
tve03410  Base excision repair
tve03420  Nucleotide excision repair
tve03430  Mismatch repair
tve03440  Homologous recombination
Module
tve_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TRV_00602
   00240 Pyrimidine metabolism
    TRV_00602
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TRV_00602
   03410 Base excision repair
    TRV_00602
   03420 Nucleotide excision repair
    TRV_00602
   03430 Mismatch repair
    TRV_00602
   03440 Homologous recombination
    TRV_00602
DNA replication proteins [BR:tve03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    TRV_00602
DNA repair and recombination proteins [BR:tve03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      TRV_00602
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     TRV_00602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4 Med13_C
Motif
Other DBs
NCBI-GeneID: 9580729
NCBI-ProteinID: XP_003025236
UniProt: D4D0K7
AA seq 248 aa AA seqDB search
MDNQRFSNYQADEPPGSQRRQTDRQTDTNNGSFLSTAKQQESHYRIKILLLTVDMAPRRK
AAESRKSNQATLQFGTQSKISKPFSNASIPGKDLKQKSPSPKEISLPTHSLPKKQDEEQQ
QLQEPTAEVTTTPASTTSTAVVHEQARAEAALPKSKEDEQAEALTLKQLHAYWRAEERKR
TASRANKQQKQADRNIICQPCIGIARIKRWRRAHALGLNPPIEVLAVLLKEETREKASEK
AYIDELLS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccagcgtttttctaactaccaagccgatgagcctccaggcagccagcgacga
cagacagacagacagacagacaccaacaacggcagcttcttatcaacagcgaaacaacaa
gagtcccactatcgcatcaagattctcttactcaccgtcgacatggccccccgccgaaaa
gccgccgagtcgcgcaaaagcaaccaggcaaccctccagttcggcacgcagtcgaagata
tcaaagcccttctccaatgcctcgatacccggcaaggacttgaagcagaagtctccctcg
cccaaggagatctccctacccacccacagcctgccaaagaagcaggacgaggagcaacaa
cagctgcaagaacctaccgccgaagtcacgaccactcccgcgtccacgacttcaacagcc
gtcgtacacgagcaggccagagccgaggcagcgttgccaaagtcgaaggaagatgagcag
gcagaggcattgacgctgaagcagctgcatgcgtactggcgggcggaggaaagaaagcga
actgcctcgagagcaaacaagcagcagaaacaagctgaccgaaatatcatctgtcagcca
tgcattggaattgcacggataaaacgctggagacgagctcatgctctcggcctgaatccg
cctattgaagtccttgctgtcttgctaaaggaagagacgcgggagaaagcgagcgagaag
gcatacatagacgagttgctatcgtga

DBGET integrated database retrieval system