KEGG   Trichophyton verrucosum: TRV_00602Help
Entry
TRV_00602         CDS       T01615                                 

Definition
DNA polymerase delta subunit 4, putative
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
tve  Trichophyton verrucosum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TRV_00602
   00240 Pyrimidine metabolism
    TRV_00602
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TRV_00602
   03410 Base excision repair
    TRV_00602
   03420 Nucleotide excision repair
    TRV_00602
   03430 Mismatch repair
    TRV_00602
   03440 Homologous recombination
    TRV_00602
DNA repair and recombination proteins [BR:tve03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      TRV_00602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 248 aa AA seqDB search
MDNQRFSNYQADEPPGSQRRQTDRQTDTNNGSFLSTAKQQESHYRIKILLLTVDMAPRRK
AAESRKSNQATLQFGTQSKISKPFSNASIPGKDLKQKSPSPKEISLPTHSLPKKQDEEQQ
QLQEPTAEVTTTPASTTSTAVVHEQARAEAALPKSKEDEQAEALTLKQLHAYWRAEERKR
TASRANKQQKQADRNIICQPCIGIARIKRWRRAHALGLNPPIEVLAVLLKEETREKASEK
AYIDELLS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccagcgtttttctaactaccaagccgatgagcctccaggcagccagcgacga
cagacagacagacagacagacaccaacaacggcagcttcttatcaacagcgaaacaacaa
gagtcccactatcgcatcaagattctcttactcaccgtcgacatggccccccgccgaaaa
gccgccgagtcgcgcaaaagcaaccaggcaaccctccagttcggcacgcagtcgaagata
tcaaagcccttctccaatgcctcgatacccggcaaggacttgaagcagaagtctccctcg
cccaaggagatctccctacccacccacagcctgccaaagaagcaggacgaggagcaacaa
cagctgcaagaacctaccgccgaagtcacgaccactcccgcgtccacgacttcaacagcc
gtcgtacacgagcaggccagagccgaggcagcgttgccaaagtcgaaggaagatgagcag
gcagaggcattgacgctgaagcagctgcatgcgtactggcgggcggaggaaagaaagcga
actgcctcgagagcaaacaagcagcagaaacaagctgaccgaaatatcatctgtcagcca
tgcattggaattgcacggataaaacgctggagacgagctcatgctctcggcctgaatccg
cctattgaagtccttgctgtcttgctaaaggaagagacgcgggagaaagcgagcgagaag
gcatacatagacgagttgctatcgtga

DBGET integrated database retrieval system