KEGG   Trichophyton verrucosum: TRV_00602Help
Entry
TRV_00602         CDS       T01615                                 

Definition
DNA polymerase delta subunit 4, putative
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
tve  Trichophyton verrucosum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tve00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tve00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:tve03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:tve03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:tve03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:tve03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tve03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 248 aa AA seqDB search
MDNQRFSNYQADEPPGSQRRQTDRQTDTNNGSFLSTAKQQESHYRIKILLLTVDMAPRRK
AAESRKSNQATLQFGTQSKISKPFSNASIPGKDLKQKSPSPKEISLPTHSLPKKQDEEQQ
QLQEPTAEVTTTPASTTSTAVVHEQARAEAALPKSKEDEQAEALTLKQLHAYWRAEERKR
TASRANKQQKQADRNIICQPCIGIARIKRWRRAHALGLNPPIEVLAVLLKEETREKASEK
AYIDELLS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccagcgtttttctaactaccaagccgatgagcctccaggcagccagcgacga
cagacagacagacagacagacaccaacaacggcagcttcttatcaacagcgaaacaacaa
gagtcccactatcgcatcaagattctcttactcaccgtcgacatggccccccgccgaaaa
gccgccgagtcgcgcaaaagcaaccaggcaaccctccagttcggcacgcagtcgaagata
tcaaagcccttctccaatgcctcgatacccggcaaggacttgaagcagaagtctccctcg
cccaaggagatctccctacccacccacagcctgccaaagaagcaggacgaggagcaacaa
cagctgcaagaacctaccgccgaagtcacgaccactcccgcgtccacgacttcaacagcc
gtcgtacacgagcaggccagagccgaggcagcgttgccaaagtcgaaggaagatgagcag
gcagaggcattgacgctgaagcagctgcatgcgtactggcgggcggaggaaagaaagcga
actgcctcgagagcaaacaagcagcagaaacaagctgaccgaaatatcatctgtcagcca
tgcattggaattgcacggataaaacgctggagacgagctcatgctctcggcctgaatccg
cctattgaagtccttgctgtcttgctaaaggaagagacgcgggagaaagcgagcgagaag
gcatacatagacgagttgctatcgtga

DBGET integrated database retrieval system