KEGG   Trichophyton verrucosum: TRV_00702Help
Entry
TRV_00702         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
tve  Trichophyton verrucosum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tve00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TRV_00702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 368 aa AA seqDB search
MTGLFGNISSNTTAATSTTTGDISKDVALVAPPEDSISDLAFSSQSDHLAVASWDKKVRI
YEINEQGMSEGKAMFEHQAPVLNCCWSPDGSKVVGVGVDKAARMLDLQGNPTTPVQVAAH
DAPIRSCCMIQNPGNSAQPLLVTGSWDKTVKYWDLRQSTPIGTLQCQERVYSMDVSKTLL
VVATADRYINIIDLNQPTNIYKVMQSPLKWQTRVVSCFTDGTGFAIGSIEGRCAIQYVEE
KDSSSNFSFKCHRETPQGQSNVSNVYSVNSIAFHPQHGTFSTAGSDGTFHFWDKDAKHRL
KGYPSVGGTISTSTFNRNGNIFAYAVSYDWSKGYTGNTPQTLNKVMMHPVTPEEVKPRAT
SANARRNR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcctgtttggcaacatctcctcgaatactaccgcagcgacctccacaacaacg
ggcgatatctcaaaagacgtagccctggttgcaccgccagaggatagcatttcagaccta
gccttctccagccagagcgaccacctagccgttgcatcatgggacaagaaagtgcgcatc
tacgagatcaatgagcaggggatgagcgaaggaaaggccatgttcgaacatcaggcaccc
gttcttaattgctgctggtccccggatggctcaaaagtggtcggtgtcggagtagacaaa
gctgcccgtatgcttgaccttcagggtaaccctaccactcctgtccaggtcgctgctcat
gacgcgcccatccgaagctgctgcatgattcaaaacccgggaaactcggctcagccgctc
ctcgtcactggctcgtgggataaaaccgttaaatactgggacctaaggcagtctacccca
attgggactctacagtgccaggagagagtctactccatggacgttagcaaaactctactt
gttgttgcgacggccgacaggtatatcaacatcatcgacctcaatcaaccaacgaatatc
tacaaagtcatgcagtctccactcaagtggcagacacgggttgtgagctgctttaccgat
ggaaccgggttcgctataggaagtatcgaaggccgatgcgccattcaatatgttgaggaa
aaagactcgagctcgaatttcagcttcaaatgccaccgtgaaactccccagggccaatca
aacgtgagcaacgtttattctgtcaactctattgctttccatcctcaacacggcacattc
agcactgctgggagtgacggaaccttccacttctgggataaagacgcaaaacatcgtctc
aagggttatccatccgtcggaggcaccatatccacctcaacattcaacagaaacggtaat
atttttgcgtacgccgttagctatgactggagcaaaggttatactggcaacaccccccag
acattaaacaaagtcatgatgcacccagtcacgccggaggaagtaaaaccaagagcaaca
tcggcaaatgcacgaaggaacagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system