KEGG   Trichophyton verrucosum: TRV_00811Help
Entry
TRV_00811         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  translation initiation factor 4E
Organism
tve  Trichophyton verrucosum
Pathway
tve03013  RNA transport
Module
tve_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:tve00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TRV_00811
Messenger RNA biogenesis [BR:tve03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     TRV_00811
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     TRV_00811
Translation factors [BR:tve03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    TRV_00811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 9580498
NCBI-ProteinID: XP_003025006
UniProt: D4D163
AA seq 240 aa AA seqDB search
MAAENGTKPEQAVNNENSTPDGTEAQNKDEQITVFHDPINFNVKHPLMNEWTLWFTKPPS
GKGDNWNDLLKEVVTFNSVEEFWGIYNNIAPTSQLSFKSDYHLFKKGVRPEWEDQQNKHG
GKWSYSFKFTKDRNQVPIDELWLHAQLTVIGDTLENDGDNEVMGVVVNVRKSFYRIGLWT
RTIGRASNERSQDQAQKILLAIGRRFKEVLKLKDNELLEFSGHTESANAGSTRAKAKFTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggaaaacggaaccaagcccgaacaggccgtgaacaacgagaactccactcca
gacggcactgaggctcagaacaaggatgaacagatcacggtcttccatgatcccatcaac
ttcaacgtcaaacaccctctcatgaacgaatggactctgtggttcacaaaacctccaagt
ggcaagggcgacaactggaacgatctgctcaaggaagtcgtcacttttaactccgtcgaa
gaattctggggaatatataataatatcgcgcctacctctcagctcagcttcaagtcagac
taccatctattcaagaagggagtcagaccggaatgggaagatcaacaaaacaagcatggc
ggcaagtggtcgtactcttttaaattcaccaaggaccggaaccaggttcccattgacgaa
ctctggctacatgcccaacttacggtgattggagatactctcgaaaatgacggtgacaac
gaagttatgggagttgtcgttaacgtgcgcaagtctttttaccgaatcggtctatggacc
cgaacaattggacgtgctagcaatgagcgctcgcaagatcaagcacagaagattctcttg
gctattggcagacggttcaaggaagttctgaaactgaaggacaatgagctcctcgaattc
tccggccacactgagagtgccaatgcaggaagcacccgtgctaaagccaagtttacagtc
tga

DBGET integrated database retrieval system