KEGG   Trichophyton verrucosum: TRV_01032Help
Entry
TRV_01032         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tve  Trichophyton verrucosum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TRV_01032
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TRV_01032
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TRV_01032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 370 aa AA seqDB search
ALAAVGQCQLMSTWDSLFSHLRQPIAQILITRNDIVDRTQYVNAQNTLAQLLSMGVIPIV
NENDTLTVSEIKFGDNDTLSAITAAMIEADYLFLMTDVDGLYTANPRTNPDARVIDIVQD
ISSLEADVSSAGSSLGTGGMGSKIVAARLATSAGVTTVITRSSRPGTIEEIIEHHSSNDA
TSSDSALGVEETKPDPPLHTCFLPSDSPVHSRSFWLLHGLKPHGSVYIDEEAYNTIRDTG
YLLPSGVIAVEGKFGYMEAIKVMVAPRPSQIELNDDYPMACSTPKEAKEVGRGLINYGYA
ELSRIKGLRSTQIHSVLGYSGSEYAVSRENLAFFEMPSRCMTPTSLSSPAPETYNDKNPL
NDIPAASANQ
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gctttggcagcagtcggtcaatgccagctcatgagtacgtgggatagcttgtttagccac
ttgcgccagcccattgcccagatccttatcacgcggaatgatattgttgatcggactcaa
tatgtaaatgcccaaaatacacttgctcagcttcttagcatgggtgtaatcccaatcgtc
aatgagaatgatactctgactgtatcggaaatcaaatttggcgacaatgatacgctttct
gctatcactgcagcgatgatcgaagcagactacctcttccttatgaccgatgtagatggg
ctctacaccgccaacccccggaccaatcccgatgctcgggttatcgacattgtccaggat
atctcaagtcttgaagccgacgtgtcctccgctggatcgtcacttggtaccggtggtatg
ggctcaaagatagtggcggcaagactagccacaagtgcgggcgttaccactgtcatcacc
cgtagttcccgtcccggaactatcgaggagattatcgagcatcattcgtccaatgacgct
acttcatccgatagtgctctgggtgtggaagaaacaaagcccgatccaccgttgcacacc
tgtttcctcccttcagactcgcccgtacattctcggtccttctggcttctccatggcctc
aagcctcacggaagcgtttatatcgacgaagaggcatacaacaccatccgagacacaggc
tatctccttccatccggcgtaatcgcagtcgagggcaaatttggatacatggaagccatc
aaggtgatggttgcgccgcgtccatcacagattgagttaaacgatgactaccccatggcc
tgcagtactcccaaggaagcgaaggaggtaggtagaggacttatcaattacggctatgcc
gagctttcccggatcaagggcttgaggagcacccagatccattctgtgctgggatactct
ggcagtgagtatgctgtgtccagagagaacctggctttctttgaaatgccgagtcgatgc
atgaccccaacgagcctgtcttcgccggctcctgagacgtataacgacaaaaatcccctt
aatgatatccctgctgcttctgccaaccagtag

DBGET integrated database retrieval system