KEGG   Trichophyton verrucosum: TRV_01044Help
Entry
TRV_01044         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tve  Trichophyton verrucosum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tve00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 475 aa AA seqDB search
MAVHGKSWHEHDPNEIVESVVACIDGAVADFETQGHKIDSIKAIGITNQRETTVVWDKET
GEPLYNAIVWTDTRTQGLVRGLKNRLGHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKE
AYDEGRLAFGTIDTWLIYKLNGGPEGGVFVTDPSNASRTMFMNLEKVEYDERLIDFFRLD
TSKIHLPKIVHSADPKAYGKLAISALKGFPITGCLGDQSAALVGQKGFTPGKAKNTYGTG
CFLLYNIGEKPVVSKHGLLTTVAFDFRGGEGGKLTYALEGSIAVGGSSVKFLVNNFKFMD
SSKDLTTLAETVPDSGGCVFVTAFSGLFAPYWIDDARGTIFGITTFTQRGHVARATLEAT
CFQTKAILDAMEKDSGHKLTELAVDGGMCASDLTMQTQADLISIPVNRPKMRETTALGAA
IAAGIAAGVWSNLEELQNVNIDGQTTFNPSIEREEADKRFSRWEKAVEMCRGWAN
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctgtacatggaaagtcatggcatgagcatgacccaaacgagatcgtcgaatccgtt
gttgcttgcatagatggcgccgtcgccgatttcgaaacccagggacacaaaatcgattct
atcaaagcgattgggatcactaaccagcgggagaccacggtagtatgggataaggagacg
ggcgagccgctgtataatgctatagtttggacggatacccgcacacagggtcttgtgcgc
ggactaaaaaaccgcctgggccaccaagagctgcaaccgatctgcggtttaccactgtcc
acctatccatccgtcggtaaagtgttatggctgatcgataacgttcctaaagtcaaggag
gcatatgatgagggaagacttgcgttcggcaccatcgacacttggctcatttacaagcta
aacggtggtccggagggaggcgtctttgtaacggatccatcaaacgcatcgcgaaccatg
tttatgaaccttgagaaggtggaatatgatgagaggttgattgacttcttccgccttgac
acttccaagatccatctgcctaagattgtacactcagcagacccaaaggcttatggaaaa
ttggcgatctctgccctcaagggcttccccataactggctgcttaggagaccaatctgct
gcgctcgtgggtcaaaagggattcacacctggaaaggccaagaacacatatgggactggc
tgcttccttctgtataatattggcgagaaaccggtagtatcaaagcatggattgctaaca
actgtagcctttgacttccgaggaggtgaaggtggaaagctcacctatgcactcgaagga
agcattgctgttggcgggtccagtgtcaaatttttggtgaacaatttcaagttcatggac
agctcgaaggatttgacaaccttggcagagacagtaccagacagcggtggatgtgtgttt
gtcacagcatttagtggattgtttgctccatattggatcgatgatgcgagaggcacgata
tttgggataacaacattcactcaacgaggccatgtagccagagcaactcttgaggcgaca
tgtttccagaccaaggcgatcctcgatgccatggagaaagacagcggacataagctcact
gagctagctgttgacggaggaatgtgtgccagcgatttgacaatgcagacacaagcagat
ttgatctccatccctgtcaaccgccccaagatgcgagagaccacggcccttggtgctgca
attgcagcaggtattgctgctggggtatggagcaacctggaggagctccaaaatgtcaac
atagacggccaaaccacctttaatcctagcattgaaagggaagaggccgacaaacggttc
tcccgctgggaaaaggctgtggaaatgtgtcggggatgggcaaactag

DBGET integrated database retrieval system