KEGG   Trichophyton verrucosum: TRV_01044Help
Entry
TRV_01044         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tve  Trichophyton verrucosum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TRV_01044
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TRV_01044
Exosome [BR:tve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TRV_01044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 475 aa AA seqDB search
MAVHGKSWHEHDPNEIVESVVACIDGAVADFETQGHKIDSIKAIGITNQRETTVVWDKET
GEPLYNAIVWTDTRTQGLVRGLKNRLGHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKE
AYDEGRLAFGTIDTWLIYKLNGGPEGGVFVTDPSNASRTMFMNLEKVEYDERLIDFFRLD
TSKIHLPKIVHSADPKAYGKLAISALKGFPITGCLGDQSAALVGQKGFTPGKAKNTYGTG
CFLLYNIGEKPVVSKHGLLTTVAFDFRGGEGGKLTYALEGSIAVGGSSVKFLVNNFKFMD
SSKDLTTLAETVPDSGGCVFVTAFSGLFAPYWIDDARGTIFGITTFTQRGHVARATLEAT
CFQTKAILDAMEKDSGHKLTELAVDGGMCASDLTMQTQADLISIPVNRPKMRETTALGAA
IAAGIAAGVWSNLEELQNVNIDGQTTFNPSIEREEADKRFSRWEKAVEMCRGWAN
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctgtacatggaaagtcatggcatgagcatgacccaaacgagatcgtcgaatccgtt
gttgcttgcatagatggcgccgtcgccgatttcgaaacccagggacacaaaatcgattct
atcaaagcgattgggatcactaaccagcgggagaccacggtagtatgggataaggagacg
ggcgagccgctgtataatgctatagtttggacggatacccgcacacagggtcttgtgcgc
ggactaaaaaaccgcctgggccaccaagagctgcaaccgatctgcggtttaccactgtcc
acctatccatccgtcggtaaagtgttatggctgatcgataacgttcctaaagtcaaggag
gcatatgatgagggaagacttgcgttcggcaccatcgacacttggctcatttacaagcta
aacggtggtccggagggaggcgtctttgtaacggatccatcaaacgcatcgcgaaccatg
tttatgaaccttgagaaggtggaatatgatgagaggttgattgacttcttccgccttgac
acttccaagatccatctgcctaagattgtacactcagcagacccaaaggcttatggaaaa
ttggcgatctctgccctcaagggcttccccataactggctgcttaggagaccaatctgct
gcgctcgtgggtcaaaagggattcacacctggaaaggccaagaacacatatgggactggc
tgcttccttctgtataatattggcgagaaaccggtagtatcaaagcatggattgctaaca
actgtagcctttgacttccgaggaggtgaaggtggaaagctcacctatgcactcgaagga
agcattgctgttggcgggtccagtgtcaaatttttggtgaacaatttcaagttcatggac
agctcgaaggatttgacaaccttggcagagacagtaccagacagcggtggatgtgtgttt
gtcacagcatttagtggattgtttgctccatattggatcgatgatgcgagaggcacgata
tttgggataacaacattcactcaacgaggccatgtagccagagcaactcttgaggcgaca
tgtttccagaccaaggcgatcctcgatgccatggagaaagacagcggacataagctcact
gagctagctgttgacggaggaatgtgtgccagcgatttgacaatgcagacacaagcagat
ttgatctccatccctgtcaaccgccccaagatgcgagagaccacggcccttggtgctgca
attgcagcaggtattgctgctggggtatggagcaacctggaggagctccaaaatgtcaac
atagacggccaaaccacctttaatcctagcattgaaagggaagaggccgacaaacggttc
tcccgctgggaaaaggctgtggaaatgtgtcggggatgggcaaactag

DBGET integrated database retrieval system