KEGG   Trichophyton verrucosum: TRV_01194Help
Entry
TRV_01194         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
tve  Trichophyton verrucosum
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:tve00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    TRV_01194
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     TRV_01194
Protein kinases [BR:tve01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   TRV_01194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 545 aa AA seqDB search
MSSPAPAPVLKTPVPGAHRNHKLPSLTLGIPPSPNAKPVNQTGVAAPAPAPVPALAINVP
QKPASRGPPKLRLATPMGATGGGNKPAFQDANALHNGRPIPQHYNSTGSSDSNSNGQINN
VHSRSGSFTGGPDARGSGPPTSASSSTYSAPSFAYGLPQPYGSTPDPSSAISSVYSDLGD
GSAMERENSVNGLTDLDKLSQELGRPLDVEDLDDERWLAASEQGKIIELGSLGEGAGGAV
TRCLLKGGKTVFALKASPSFFSLYSSSSIITTDPNPDVKKQIVRELNFNKGCASDYICRY
YGAFVDRSSSSISIIMELCEGGSLDSIYREVKKLGGRTGEKVLGKVAEGVLNGLTYLHGR
KIIHRDIKPSNILLCRKGQVKLCDFGVSGEFGTKGDANTFIGTSYYMAPERITGQSYTIT
SDVWSLGVTLLEVAQHRFPFPADGTEIQPRSVLIDLLTYIIHQPIPKLKDEPHNGIHWSD
NFKYFIECCITANISIQLGERPSPTSHALANARTPMDARNKEQESEYGALPEASMGLERL
EFPHN
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcccgctcccgctcccgtcctcaagactccggtgcctggcgcacatcgcaac
cacaagctcccatccctcacattgggcataccgccgtctcccaatgccaaaccggtcaac
cagacgggcgtggcagccccggctccggcaccggtaccggccctcgccatcaacgtcccc
cagaagcccgccagcagaggacccccaaagctgagactggccacccccatgggcgccacg
ggcggcggcaacaagcctgcattccaggatgccaacgctctgcacaacggccgccccatt
ccacaacactacaattcaacaggctcgtcagacagcaacagcaacggccagattaataat
gtacactcacggtcggggagctttaccggcggccctgacgccaggggtagcggacctcct
acctcggccagctcgtccacttactctgctccttcctttgcctatggccttccacagccc
tatggttcgactcctgatccttcttcggccatcagctcagtgtactcggatctaggcgat
ggctcggccatggagagagaaaacagtgtcaacggcctgacggaccttgacaagctcagc
caggaacttggacggcctctggacgtagaagacctggatgatgagcggtggttggctgcc
agtgaacagggcaagatcatcgagctcggcagcctcggtgagggtgccggtggagctgtc
actcgatgtctgctcaagggaggaaagaccgtttttgctttaaaggcgagtccgtctttt
ttttctctttactcttcgtcctctatcatcacaaccgacccgaatccagatgtcaagaaa
cagattgttcgagagcttaatttcaacaagggatgtgcttcagactacatatgcagatac
tatggtgcattcgtcgaccggtcaagtagctcgatatccatcatcatggaactatgcgaa
ggcggcagtctagacagcatatacagagaagttaagaaacttggtggtcgaaccggagag
aaggtgcttggaaaagttgccgagggcgtcttgaacggcctgacatacctccacggccga
aagatcatccacagagatataaaaccttcgaatatccttctctgccgcaaaggccaagtc
aagctttgtgactttggtgtaagcggcgaattcgggaccaagggcgatgcaaacactttc
attggcacatcctactacatggcccctgagagaatcactggacagtcctacaccatcacc
tccgacgtctggtccctcggagttacactgcttgaagttgcacagcaccgattccccttc
cctgccgacgggacagagatccagcctagatcggtcctcattgaccttctcacttacatc
atccatcagcccatcccaaaactcaaggacgagcctcacaacggcatccactggagtgac
aactttaaatacttcatcgaatgctgtatcacagctaacatatctattcagcttggagaa
agaccatccccgacgagccacgccctggcgaatgctagaacacccatggatgctcgaaat
aaagaacaagaaagtgaatatggcgcacttcctgaagcaagtatggggctggaacgatta
gaattcccacacaactaa

DBGET integrated database retrieval system