KEGG   Trichophyton verrucosum: TRV_01347Help
Entry
TRV_01347         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tve  Trichophyton verrucosum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TRV_01347
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TRV_01347
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TRV_01347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 174 aa AA seqDB search
MSSATSFYNFEPVDKKGEPFPLASLKGKVVLVVNTASKCGFTPQFAGLEELYKSITASHP
DKFTILGFPCNQFGGQDPGSNDEIQSFCQVNYGVTFPVLGKIDVNGDNTAPVFNWLKKEM
PGLMGLKRVKWNFEKFLVDADGKVVGRWASTTKPESLKATILEEIEKAGKKSQL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcagctacgtccttttacaacttcgagccagttgataagaaaggagagccgttc
cccctcgcctcgctgaaaggcaaagtagtccttgttgtcaacactgcgtcaaaatgcggc
tttacaccacaattcgccggccttgaagagctctacaagtcaatcacggcctcccaccca
gataaattcaccatcctaggcttcccgtgcaaccagttcggcggccaggaccccgggagc
aacgatgagatccagtccttctgccaggtcaactacggcgtcacattccccgtgctcggc
aagatagacgtcaacggcgataacactgcgccggtgttcaactggctgaagaaggagatg
cctggtctcatgggcctgaaaagggtcaagtggaactttgagaagttcctggtcgatgcg
gacgggaaggtcgtcggccgatgggcgagtaccacaaagccagagtcgctcaaggctacc
atcctggaggagatcgagaaggctggaaagaagtctcagctgtag

DBGET integrated database retrieval system