KEGG   Trichophyton verrucosum: TRV_01404Help
Entry
TRV_01404         CDS       T01615                                 

Definition
NADPH-cytochrome P450 reductase (CprA), putative
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tve  Trichophyton verrucosum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 694 aa AA seqDB search
MAQVDTLDMLVLAVILVGTIAYFTKGKYWAVVKDPYASSYAATNSAKQGQTRNIVEKLEE
TGKNCVIFYGSQTGTAEDYASRLAKEGSQRFGLKTMVADLEDYDYACLDKFPEDKVAFFV
LATYGEGEPTDNAVEFFQFITGDDASFEDGGSPEDQPLSKMRYVAFGLGNNTYEHCNAMV
RIVDKALTKCGAKRIGDAGEGDDGAGTMEEDYLAWKEPMWKALAEEMGLEEREAIYEPTF
SVIEEADLNTESENVYLGEPNASHLKSRGQGPYNAHNPFLSPIVESRELFSVKDRNCLHM
EFDIKGSQLNYQTGDHIAIWPTNAGQEVDRFLKVFGLEEKRHTVIRVKPIDVTAKVPFPQ
PTTYDSVVRYYIETCGPVSRQFISQLAAFAPDEETKKKMIRIGEDKDVFSDKVSAFYFNI
AQALQSFTDKPFTAVPFSLLIEGIPKIQPRYYSISSSSIVQKEKISITAVVESLRVPGAG
HVVKGVTTNYLLALKQKQHGEPNPDPFGLTYAISGPRNKYDGFHVPVHVRHSNFKLPSDP
SKPIIMVGPGTGVAPFRGFIQERVHQAEKGETVGPTILFYGCRKSTEDFLYKEEFEEVSK
KLGDSFKLITAFSRETSQKVYVQHRLKEHAELVSDLLSKKANFYVCGDAANMAREVNVVL
GQILAEQRGLKPEKGEELVKHMRNTGSYQEDVWS
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggttgacactctggacatgcttgtcctggcggtaatactcgtcgggacgata
gcatacttcaccaagggcaaatactgggccgtcgtaaaggacccctatgcctcctcctac
gccgcaacaaacagcgcaaagcaaggtcaaacccggaatatcgtcgagaagctcgaagaa
accggcaagaactgtgtcatcttctatggctcgcagaccggtactgccgaagactatgcc
tccaggctggcgaaggagggatcccagcgattcggcctcaagaccatggttgccgatctg
gaagactatgactatgcctgcctcgataaattccccgaagacaaggttgccttcttcgtc
ctggctacctatggtgagggtgaaccgacagataacgcggtcgagttcttccagttcatc
accggtgacgatgccagttttgaagatggcgggtcgccggaagaccagccgctctccaag
atgcgatatgttgcgtttggtctcggaaacaacacctacgaacactgcaacgccatggtt
agaattgtggataaggctctgaccaagtgtggtgctaagagaatcggtgatgctggagaa
ggcgatgacggtgctggaaccatggaagaggactatctcgcctggaaggaacccatgtgg
aaggctctggctgaagagatgggccttgaagagagagaggctatctacgaacctaccttc
agcgtcattgaagaagcggacttgaacaccgaatcggagaatgtctatctcggcgagcca
aacgcttctcacctcaagagtcgaggccagggaccttacaacgcccataacccattcctc
tcacccattgttgagtctcgtgaactgttctccgtcaaagaccgtaactgcctgcacatg
gaattcgacatcaagggaagccagctcaattaccagaccggtgaccacatcgctatctgg
cccaccaatgccggccaggaagttgaccgtttcctcaaagtgtttggtctggaagaaaag
cgtcataccgtcatccgtgttaagcctatcgatgtcaccgccaaagtcccgttcccccag
ccaaccacctatgactccgtggtcagatactacattgaaacctgcgggcccgtatcgcga
cagttcatctcccagctcgctgcattcgctccggatgaagagaccaagaagaagatgatt
cgcattggcgaagataaagacgttttctcagataaggtgtctgccttctacttcaacatt
gcccaggctctgcaatccttcaccgataagccctttaccgccgttccgttctccctgctc
atcgaaggcattcccaagatccagccaagatactactccatttcttcgtcgtctatagtc
cagaaggaaaagatcagcatcactgctgttgttgaatcgttacgtgtccccggcgctggc
catgttgtcaaaggtgtaacaaccaactatcttcttgctttgaaacagaaacagcatggc
gagcccaacccagatccattcggtctgacctatgccatttctgggccgcgcaacaaatac
gatggcttccatgtccctgtccatgtgcgtcactccaacttcaagcttccgtctgatcct
tcgaagccaatcatcatggttggtcctggtaccggtgtcgctccattccgtggtttcatc
caggaacgagtccaccaggctgaaaagggcgagaccgtcggtcctactatccttttctac
ggctgccgtaagagcacagaggatttcctttacaaggaagagttcgaggaggtgtccaag
aaactcggcgattccttcaagcttatcactgctttctcccgtgagacttctcagaaagta
tacgtccaacaccgtcttaaggaacacgccgagctagtcagcgaccttctctccaagaag
gcaaatttctatgtctgcggagatgcagccaacatggctcgagaagtcaacgttgtccta
ggccagatcctcgctgagcaacgaggcctgaaacccgagaagggcgaggaactcgtcaag
catatgcgaaacaccggctcgtaccaggaggatgtctggtcgtga

DBGET integrated database retrieval system