KEGG   Trichophyton verrucosum: TRV_01408Help
Entry
TRV_01408         CDS       T01615                                 

Definition
possible replication factor-a protein
Orthology
K10739  
replication factor A2
Organism
tve  Trichophyton verrucosum
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tve00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TRV_01408
   03420 Nucleotide excision repair
    TRV_01408
   03430 Mismatch repair
    TRV_01408
   03440 Homologous recombination
    TRV_01408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 284 aa AA seqDB search
MGEFHSIRRLFRELTNAYRLRTYSGESRSVRPVTIKQLNDATQAFPEAPFKIDNADINQV
CFVGQVRNVNKLATHITYKLDDGTGETDVKYFIPPEEKEAFDELEAMDVMAMDGAGSNAG
PAAVTNKSGRPRAHQITTNGYAKVFANVKTFNDRRQVNAVLIRPITNINEYHVHFLEATA
VHLYFTKGPPPKAGGASGTGAGTGGGAMDMGGSNLSLPRISPMARKLYNALSNSRQTNEG
MHVNVLAPIMQVNVNEVYKAAEELLGLSVIYHTVDEDTWKILDC
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagtttcattctatacgtcgcctgttcagagagctaaccaacgcgtacagacta
cggacatactctggtgaatctagatcagttcgaccagtgaccatcaaacaattaaacgat
gccacccaggcattccccgaagcccccttcaaaatagataacgccgatatcaatcaagta
tgttttgtgggacaggttcgaaatgtcaataaactagccacacacatcacgtacaagcta
gacgacggcacgggagagacggacgtgaaatatttcatcccccctgaagaaaaagaagcg
tttgatgagcttgaagctatggatgtcatggctatggatggtgcgggtagcaatgctggt
ccagctgctgtgacaaacaagtctggacgaccgagagcccaccagataacaacaaacgga
tacgcaaaggtgtttgccaatgttaaaacatttaatgaccggcggcaggttaacgcggtg
ttaatccggcccataacgaatattaacgagtaccatgttcatttccttgaggccacggca
gtacatctctatttcaccaagggcccgccaccgaaggcaggcggtgcttctgggacggga
gctggaaccgggggtggtgcgatggatatgggtggcagcaatctctccctaccgcgaata
tcaccgatggcacgaaaactatataatgctctcagcaacagcaggcagactaatgagggc
atgcatgtgaatgtcctggcgccgataatgcaggtgaacgtaaatgaagtctataaagct
gccgaggagctcctgggactcagtgtgatataccacacggtagatgaggacacctggaag
attcttgactgctga

DBGET integrated database retrieval system