KEGG   Trichophyton verrucosum: TRV_01447Help
Entry
TRV_01447         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K12666  
oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
tve  Trichophyton verrucosum
Pathway
N-Glycan biosynthesis
Various types of N-glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:tve00510]
Metabolism; Glycan biosynthesis and metabolism; Various types of N-glycan biosynthesis [PATH:tve00513]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tve04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 497 aa AA seqDB search
MKLLAALLLSCGLVSATAANTTATEPAIQVLPKNFRPPQVFRNNNLVRIINLEKSYVRES
INVVVENVDKRPQSEYYVAFPTDTINKVGGLEGWPKDSEEKKKFTVTSTRQVPSSSHQYF
IIHLHQPLEPAAKLTLTLSYHLQSALTPILAAIEQDGKQYLSYTFPQFVPSAYTTNKQKT
TVKFRGTDVPDYTRPTTLKSEEDPKREGSTFTYGPYDMEVKPGTSAPITVRYEYTRPVVT
CTRLERDIEISHWGGNMATEDRFWFRNDAAKLTKQFSRVEWTKKQFHNAQSVALNLLRVP
LAPGSVNPYFIDDIGNVSTSRFLPATETRLGLLDLRPRYPIFGDWKYSFKIGWNNPLSSV
LRKQKTGSGESYVLKVPFIDGPKIPEGVQYQDLEIRIILPEGAENVKYEIFDGLGIPNHI
RSEISYYKTFLDTKGRTVLNLSTTKVGDEAKDGFIIVTYDYPFLAAFRKPLSIFGAMLAV
FTAAWVLGNIDVSIKRR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgctcgccgcgctgctgctctcgtgcggcctcgtctctgcgacggccgcaaac
accacagctacagagcccgccatccaggtcctaccgaagaacttcaggccgccgcaggtc
ttccggaataacaacctagtgcgcataatcaatttggagaagagctatgtgcgggagtcg
atcaacgttgtggttgaaaatgtcgacaagcggccgcagtcagagtactatgtggccttt
ccaacagacacaatcaacaaagtcggcggcctcgaaggctggccgaaagactcggaagag
aagaagaagttcacagtaacgtcgacacggcaggttccttcaagctcgcatcaatacttc
atcatacaccttcatcaacctctcgaaccggctgcaaagctgaccctgacgctgtcatac
catctgcaatccgctcttactcctattctggctgcaattgaacaggatggcaagcaatat
ctctcctataccttcccgcagttcgtgccgtccgcgtacaccaccaacaagcagaagacg
accgtcaagttccgtggcacagatgttccagactacactcgacctaccactctcaagtcc
gaagaggaccctaagcgtgaaggcagcacctttacatatggcccgtatgatatggaagtc
aaaccaggcaccagtgcacccatcaccgtccgctacgagtacacccgacccgtggtgacc
tgcactcgcctcgagcgtgatatcgagatatcccactggggcggtaatatggccactgaa
gaccgattctggtttagaaacgacgctgccaaactgaccaaacagttctcccgagtcgaa
tggaccaagaagcagttccacaacgcacagagcgtagctttgaacttgctcagagtgccc
cttgctccagggtctgtcaacccttacttcattgacgacatcggcaatgtctcgactagc
cgattcctacctgctacagagactcgtctcggcctcttggatttacgcccacgttacccc
atcttcggcgattggaagtacagcttcaagatcggctggaacaacccactctccagcgtt
ttgcggaaacagaaaactggctctggcgagtcctacgttctcaaagtgcccttcattgac
gggccaaagatccctgagggcgttcagtatcaggacttggaaatcagaatcattctgccc
gagggagctgagaatgtcaaatacgagatttttgacggattgggtattcccaaccatatc
cgctctgaaatttcatactacaagacctttttagataccaagggtagaactgtcctgaat
ctctccactaccaaggttggagatgaggccaaggatggattcatcatcgtaacatacgac
tatcctttcctcgctgccttcagaaaaccattgagcattttcggcgctatgcttgcagtc
ttcactgccgcatgggtcctgggtaatattgacgttagcattaaaaggaggtag

DBGET integrated database retrieval system