KEGG   Trichophyton verrucosum: TRV_01549Help
Entry
TRV_01549         CDS       T01615                                 

Definition
beta-N-hexosaminidase, putative
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
tve  Trichophyton verrucosum
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TRV_01549
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    TRV_01549
   00603 Glycosphingolipid biosynthesis - globo series
    TRV_01549
   00604 Glycosphingolipid biosynthesis - ganglio series
    TRV_01549
   00511 Other glycan degradation
    TRV_01549
Enzymes [BR:tve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TRV_01549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 616 aa AA seqDB search
MRFAKALAITAVLLSGVVEATSDAVIEEALKARTINPLPGPVTWYLHADEGRKYLAPFVS
YHGPRQSGIRDAWERCYSTIRRLKWYPQALEGPIPKFDPFPDQSSKPKEKRQNAPPGAMI
RRVNVKVSDVNAKLAHKVDESYSLTVSARSEAIEIEAKTPWGARHAFTTLQQIVVYDETT
RQFYIERPFTIKEGPLYPIRGILLDSGRNFISPSKIKEQLDAMALSKLNVLHWHITDTQS
WPLEVRTYPQMTEDAYSKRMVYSHATIKEIIEYARQRGIRVIPEIDTPSHSSSGWKRIDP
DLVACGNSWWSNDFFPHHTALEPNPGQLDIAYNKTYEVLEKLYKEVSSLFEDEFYHLGGD
ELQPNCYKFSKHVTQWLTEHPDKTLDDLLQEYVDRTLPALDKIKHRRFIYWEDMLLSEQI
HAERIPRSVVLQTWNGGLDNIKKLTSNGYDVIVSSADFFYLDCGNGGWVSNDPRYNVMKN
PTPGTPNFNYGGDGGSWCAPYKTWQRIYDYDFASELTVPEKDHILGGIAPLWSEQIDDAN
ITPKFWPRAAALAELLWSGNRDKEGKKRTYLMTARINNFREYLVANGIGAAPLQPRYCLK
HPHHCDLYSDPNAVQG
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcgccaaagctctggccatcacggccgtgctgctgtctggcgtcgttgaagcc
acctctgatgccgttattgaggaagccctgaaagcccgtactatcaacccgctgccagga
ccggtaacctggtaccttcacgccgacgaaggccgcaagtacctcgctccctttgtttca
taccatggaccgcgccagagtggcattagggatgcatgggagagatgctacagcactatt
cgtcgcctcaaatggtatccgcaagcactcgagggccccatccccaagttcgacccgttc
cctgaccagtcctccaagcccaaagaaaagagacaaaatgctcctcccggtgccatgatc
agaagggttaacgtcaaagtctcggatgtcaatgcaaagctggctcataaagtagatgaa
tcctacagcttgacggtcagcgcaaggtccgaggccatcgaaattgaggccaaaactccc
tggggagctcgccatgcattcaccactctgcagcagattgtcgtttacgacgaaacgacc
cggcagttttacatcgagaggcctttcaccattaaagaaggtcctctgtacccaatccgg
ggcatcctgctcgattctggccgtaacttcatctccccgagtaaaatcaaggagcagctc
gatgccatggctctgtcaaagctaaacgtcctccactggcacatcactgacactcagtcc
tggccccttgaggtcagaacttatcctcagatgaccgaggatgcctattcaaagaggatg
gtctattcccacgcgactatcaaggagatcatcgagtatgctagacaacgtggaatccgt
gtcatccctgagatcgacacacccagtcactcttcctctggctggaaacggattgatcct
gatttggtggcttgtggaaattcctggtggtccaacgatttcttcccacaccacactgct
ctggagcccaacccaggacagcttgacatagcctataacaagacttacgaggtgctcgag
aagctttacaaagaagtttctagcctctttgaggacgaattctatcacctcggtggtgat
gaactgcagccgaactgctacaaattcagcaaacatgtcacccaatggcttaccgaacat
ccagataagaccttggatgacttgcttcaggagtacgttgacaggacccttccggctctc
gacaagatcaaacaccgccgtttcatctactgggaagacatgctcctctctgagcaaatt
cacgcggagaggattccaaggagcgttgtcctgcagacctggaatggcgggctcgacaac
atcaaaaagcttacctccaacggctatgatgttatcgtgtcttctgctgatttcttctac
ctcgactgcggtaatggtggctgggtcagcaatgaccccagatacaacgtcatgaaaaat
cccactcccggaacgcctaacttcaactacggcggcgacggcggttcttggtgtgctccg
tacaagacctggcaacgtatctacgactatgatttcgcctctgaacttactgtcccggag
aaggaccatattctaggcggtatcgctcctctatggtcagagcagatagatgatgctaac
atcactcccaaattctggccccgcgctgctgctcttgccgaactgctctggtccggcaac
cgtgacaaagagggcaagaagcgaacgtatcttatgactgcccgtataaacaacttcagg
gaataccttgttgccaacggtattggtgccgcaccactacagcccagatactgtcttaag
catccgcatcactgcgatctttacagtgatccgaacgcagttcagggttag

DBGET integrated database retrieval system