KEGG   Trichophyton verrucosum: TRV_01651Help
Entry
TRV_01651         CDS       T01615                                 

Definition
ubiquitin C-terminal hydrolase CreB
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TRV_01651
Peptidases [BR:tve01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TRV_01651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 876 aa AA seqDB search
ANSTSANGTAASKKDSAPLPKTPLQKLLSDAGPLKSDGSDKFFGMENSGTFSSLWDIIMS
FLTGLTSHSYCNSILQCLYYSAPFRESVINYPQRSPPESLKHALSTNFKYPDPDISLEEA
LLQTKLKQQQLATSNGVRPTLNPQNQIPKAEDKDSPEYKKKVAMHTLPVLETTDNSQNYG
MQESLFTSLKDIFESIAASEERVGVVRPQHFLDVLRRENEMFRTAMHQDAHEFLNLLLNE
VVNNVEAEANRTSMLEADADSESSTATSTSVATTLATSVGGSAKSPYSTRWVHELFEGKL
TSETECLTCEKKSQRDEAFLDLSVDLEQHSSVTSCLRKFSQEEMLCERNKFHCDNCGGLQ
EAEKRMKIKRLPRILALHLKRFKYTEDQQRLQKLFHRVVYPYYLRLFNTTDDAEDPDRLY
ELYAVVVHIGGGPYHGHYVAIIKTEDRGWLLFDDEMVEPVDKSYVRNFFGDKPGQACAYV
LFYQETTFEAMQRELQSDERMSAASKSQDADLAPLAALDLKTTGNQPIPTPPQDISRVRS
AIPQLPTTTDNSTAGSYNPIKLIPSAPQLSNIGDAPPTALPTTAANSQPATAPTPSYNKL
PISLPRIPLMSRTPDRAAEIQSKKERAREEKDRKAQEKETQKQKRKEQEKAEARLRELAK
KEEQQIKSALDASKLTAKEEKKRLSSEKKRLSSEGASDSANGNGSTNANGNGNTNGIANG
FTNGINGIAGGLGRLKLGSRTLSYSRKHKDNKDNKDKVPALPTASASAMNGNPTASDITI
TPKNFQPRELDTSSSAINDAANQPPASGSASGSGTGEQPHLASRVLAQAEQEDFSSQQQQ
SQITSLPQPPPTPSPPKQPTPRRSRFSLRKKSFSVL
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
gccaacagcacctccgccaacggtaccgcagcctcgaagaaggactcggctcccttgccc
aagacaccgctccagaaactcctctcggacgccggaccgctcaaaagtgatggcagtgac
aagttctttggcatggagaattcagggaccttctcttctctttgggatataataatgtct
ttcctaacaggccttacctctcacagctactgcaattctatcctccaatgtctatattac
tccgcccccttcagagagtccgtcataaactacccccagcgctctccgccagagtcgctc
aaacacgcactctccaccaacttcaagtacccggacccagacatctcgctcgaagaagca
ctgctccagaccaagctcaagcagcagcagctcgccaccagcaatggagtcagaccaaca
cttaacccgcagaaccagatcccaaaggcagaggacaaggactcaccagagtacaagaag
aaggtcgccatgcataccctgcccgtcctcgagacaaccgacaattctcaaaactacggc
atgcaggagtccctctttacctcgctaaaggacatattcgagtccatagcggccagcgag
gaacgcgtcggtgttgtcagaccacagcacttcctcgacgtcctacggcgggaaaacgag
atgttcagaacggccatgcaccaggacgcccacgagtttctgaacctgctgctcaacgaa
gtcgtcaacaatgtcgaggccgaggcaaacaggacgtccatgctcgaagcagatgccgac
tcagagtcaagcaccgcaacctcaacctccgtcgcaactacactggctacctctgtcggc
ggcagcgcaaagtccccctacagcactcgctgggtccacgagctgttcgaggggaaactc
acctccgaaacagagtgtcttacctgtgaaaagaaatcccagcgtgacgaggcattcctt
gatctctccgtcgacctggaacagcactcctccgtaacctcatgtctgcggaaattctcg
caggaagagatgctctgcgaacgcaacaagtttcactgtgataactgcggtggcctgcag
gaagctgaaaagagaatgaagataaagcggctacccaggatattggctctgcacctgaaa
cgcttcaagtacaccgaagaccagcaaaggttacagaagctgttccatcgtgtcgtctac
ccttactacctacgactcttcaataccaccgacgatgccgaggacccggaccgcctgtac
gagctctatgccgttgtcgtgcacatcggcggcgggccctaccatggccactatgtagct
atcataaaaaccgaagacagaggctggctgctgttcgatgacgagatggtcgaacccgtc
gacaaaagctatgtgcgcaatttcttcggtgataagccgggccaggcttgtgcatatgtc
ttgttctaccaggagactaccttcgaggccatgcagcgcgagctgcagagtgacgagcgc
atgtctgccgcttcaaagtcccaggatgcggatctggcacccttggcggctctggacttg
aaaactaccggaaatcagccaatcccaacaccgccccaggatatcagtcgggttcgcagt
gccataccccagctccctacaacgacagacaactcaaccgcaggctcatacaaccccatc
aaactgatacccagcgcaccgcagttgtcgaatataggtgatgccccgccaaccgccctc
cctaccacggcagccaattcacaaccagccactgcacctacgccatcgtacaacaaactg
cccatctctctacctcgtatccctctgatgtctcgaactcctgaccgagccgctgaaatc
cagtccaaaaaggaacgagctcgtgaagaaaaggaccgcaaggcccaggagaaagaaacc
cagaagcagaagcgcaaggaacaggagaaagcagaggcccgtctgagagaactggcgaag
aaggaagaacagcagatcaaatccgccctcgacgcaagtaaacttacggctaaagaggag
aaaaagagactgtcctctgagaagaaaaggttgtcctctgagggtgcatctgacagtgcc
aatggtaacggtagcaccaatgctaatgggaatggaaataccaatggaatcgccaatggc
ttcacgaacggcatcaacggaatcgcaggcggactgggcagactcaaacttggcagccga
acactcagctacagcagaaaacacaaagacaacaaggacaacaaggacaaagtgccagcc
ctacctactgcttctgcttctgccatgaacggcaaccctactgcttcagacatcactatc
acgcccaaaaacttccaaccacgggaactcgatacctcatccagcgcaatcaacgatgca
gctaaccagcctcccgcttcaggctctgcttccgggtctggaacgggtgagcagccccat
ctagcatccagagtcctcgcgcaggctgagcaggaggatttttcctctcagcagcaacag
tcgcagatcacttcgctgccccaaccaccccctactccatctccgccgaaacaacccacc
ccccgacgaagcaggttcagcctccgcaaaaagtcattcagtgtgctgtaa

DBGET integrated database retrieval system