KEGG   Trichophyton verrucosum: TRV_01750Help
Entry
TRV_01750         CDS       T01615                                 

Definition
agmatinase, putative
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tve  Trichophyton verrucosum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TRV_01750
Enzymes [BR:tve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     TRV_01750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 435 aa AA seqDB search
MVYLKYKTLALAGAILSAQVVDCHSHHEEGQIPLSQEELEHKWAPELRQSAFATMGSFGG
LKHVPCLTKPNELYDIAIIGAPFDTATSYRPGARFGPRAIREASGRQVAARSYNVRAGIN
PYLDWAKVIDCGNIPITQMDNRIAERQMFEAFLELGTRKTAYQPQKKGDKSKRQARISDG
KPKLVTLGGDHSIILPALRALNQIYKKPITVIHFDAHQDTWESSRYDGYWKPDVDGLNHG
TWLFHAGQEGLISNTTSAHAGLRSYLGGSDDRDYRTGVEKGFMRIHADDVDDIGTQGVVD
AIVSRVGLDPDQPVYISLDIDVLDPSIAPGTGTPESGGWTSRELARILRGLEKLNVVGAD
VVEVSPSYDHRAGGTALAAAHVVNEIIASMVKLGVEDPDAVGGWFGRKGNKSVKEGVMES
YQEGAAGSEARKDEL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggtgtacttgaaatacaagacgcttgctttggctggagccatactcagtgctcaagtg
gtggactgtcatagtcaccatgaggagggacagataccgctgagccaggaggaactggag
cataaatgggcgccggagttgaggcagtctgcatttgcgaccatgggcagctttggtggg
ctgaagcatgtcccatgcctgacgaagccaaatgagctttacgatattgctatcattgga
gcgccgttcgacacagcgacttcataccggcccggagcacggtttgggcctcgggcaatc
cgcgaggccagcggccgccaggtcgcagcccgttcatacaatgtccgggctggtatcaac
ccttacttggactgggccaaagtcatagactgcggaaacatccccatcacccagatggac
aacaggatagcagaaaggcagatgtttgaagccttcctagaactaggcacgaggaagacc
gcctaccagccgcaaaagaaaggcgacaagtccaagagacaagcgaggatatcagacgga
aagcccaagctggtaactcttggaggagaccacagcatcatcctgccggccctgcgagcg
ctgaaccagatctataaaaagccgatcaccgtcatccacttcgatgcgcaccaggacacg
tgggaatcctcccgctacgacgggtactggaagccagacgttgacggtctcaatcacgga
acctggctgttccatgcgggccaggaagggctgatttcaaacaccacgtcggcccacgcg
gggctgcgatcctatctcggcggatctgatgatagagattaccgtaccggggtagagaaa
gggttcatgcgcatccacgcggatgatgtcgatgacattggcactcagggggtggtcgat
gcgattgtctcgcgagtcggtctcgacccagaccagccggtctatatcagtttggatatc
gatgttcttgaccccagcattgcacctggaacaggcacgccggagtcaggtggctggacg
tccagggagcttgctaggatcctccgcgggctggagaagctgaatgtggttggagccgat
gtggtggaggtctcgcccagctatgatcatcgtgcgggagggactgctcttgcggctgcg
catgtagtcaacgagattattgcaagcatggtgaaactcggagttgaagatccagacgca
gtcgggggctggtttggtagaaagggcaacaagtccgtcaaggagggtgtgatggagtca
tatcaagagggcgcagcaggctcagaagcccgaaaagacgagctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system