KEGG   Trichophyton verrucosum: TRV_02022Help
Entry
TRV_02022         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tve  Trichophyton verrucosum
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    TRV_02022
Enzymes [BR:tve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     TRV_02022
Glycosyltransferases [BR:tve01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   TRV_02022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 942 aa AA seqDB search
MASKASNAGLEAKTPSKSRSKSRSKSRSPGPKGASKQSKTHDYRSDGVKDYDVLNLPVSN
YKIMLVITAIATVVRLFRIYQPSSVVFDEVHFGGFATKYIKGKFFMDVHPPLAKLLITLA
GHLAGFKGDFDFKEIGKDYLEPGVPYVAMRMLPAIMGIMTVPTMFLTLKATGCRTSTASF
GALLVTFENALVTQSRFILLDSPLIIFTALTVLSFVSFSNQHEQGPPKAFGCSWWFWLVA
SGLFLGATASVKWVGLFTIAWVGSLTLVQLWVLLGDSKTVTPHLWFKHFFARALCLIVIP
VGLYMAMFGIHFLCLRNPGEGDGFMSSEFQATLNSKGMSDTPVDVVFGSRVSIRHHNTQG
GYLHSHSHMYPGGSKQQQITLYPHKDDNNIFILENQTQPLGPYGQVPGPRAWDNITTEHI
IDGSTIRLYHMTTDRRLHSHDVRPPVTEADWQQEVSAYGYEGFEGDANDLFRVEIVPSMS
DGAEAKKRLRTIQTRFKLVHVMTGCVLFSHKVKLPEWGFDQQEVTCAKGGSLPNSIWYIE
QNSQPALPDDVEKVNYKIPNFFAKFWELHKVMWRTNAGLVDSHAWDSRPPSWPILSRGIN
FWGRHHRHIYLIGNPVIWWTSTAAVVIWVLFKGIAVLRWQRGFKDYNCVHFKRFDYEIGQ
TLLGWALHYFPFYLMARQLFLHHYLPALYFAILAFCQIYDFVANRFNKPSIFGKLFTVAF
LSLSVAAFCILSPLAYGNPWTKDMCQRTKLIPTWDFDCNLFHNDLSQYAIPEVISTSEAA
HTSIAAPPVQQQQQQQQPGEQKQEQQPEQQENQVPVQPESPQQPPAVDPELRKVREVEYR
DSEGNILSEEQVKVLQEQGEISFETRYETRTRLIDTEGRELPKEAIIAPEHPDVQGANPE
TVAKDEPKAPANKPAEVKGENESPKKKENKPKPASEAKAATN
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaggcctcgaatgccggtctggaggcaaagacgcccagcaaaagccgctcg
aagagccgttcgaagagcagatcccctggccccaagggtgcctccaagcagtcgaaaacc
cacgattaccgctccgatggcgtcaaggactacgatgtccttaaccttcccgtctcaaac
tacaagataatgcttgttatcactgcaattgcaacggtggtgcggctgttcaggatctac
cagccttccagcgtcgtctttgacgaggtccacttcggaggcttcgctaccaagtatatc
aagggcaaatttttcatggacgtccacccgccgctagctaaactgcttatcaccctcgct
ggtcacctcgccgggttcaagggagattttgacttcaaggaaattggcaaggattatctg
gaacctggtgttccctacgttgccatgcgcatgcttcccgctatcatgggtataatgacc
gtccctaccatgtttcttactctgaaagcaactggttgtcggacttcaaccgcctcgttc
ggtgctctcctggtcacctttgaaaatgcactcgttacccaatcgcgcttcattcttttg
gactctcctctgatcatcttcactgccttgaccgtcctctctttcgtctcgttctccaac
cagcacgaacaaggcccgccaaaggcctttggatgctcttggtggttctggctggtggca
tccggactattccttggagcaactgctagtgtgaaatgggttggtctcttcacgattgcg
tgggttggatcattgactctcgtccaactctgggttcttctcggggattcaaagaccgtt
actccacacctctggtttaaacacttctttgctcgtgccctctgcttgattgtcatccct
gttggcctctacatggctatgttcggaattcacttcctctgtctccgaaaccccggtgaa
ggtgatggcttcatgtcatccgaattccaagcaactctcaactcaaagggcatgagtgat
actcccgtcgatgttgtctttggctctagggtatctatcagacatcacaatacacaggga
ggctacctccactcacacagccacatgtaccccggcggaagcaagcagcaacaaatcacc
ctttacccccacaaggatgacaacaacatcttcattctcgagaaccagactcagcctctc
ggaccatatggccaggttcctggaccacgggcctgggataacatcactacagaacacatc
attgacggcagcaccatcaggctctaccatatgactactgacagacgcctccactctcat
gatgttcgtcctccagttaccgaagctgattggcagcaggaagtttccgcctatggctac
gaaggattcgagggagacgccaatgacctcttccgcgtggaaattgtcccttccatgtct
gatggagcggaggcaaagaagaggctgaggacgatccagacgaggttcaagcttgtgcac
gttatgactggctgtgttttgttctcccataaagtgaaactgccagaatggggcttcgac
caacaagaggttacctgtgccaagggtggttccctgcccaacagcatctggtacattgaa
cagaacagccagcccgctctccctgatgacgttgagaaagtgaactacaagattcctaac
ttcttcgccaaattctgggagcttcacaaggttatgtggaggacaaacgctggcctcgtc
gactctcatgcttgggactcacgtccaccatcctggcccatcctgtcccgtggtatcaac
ttctggggcagacaccaccgtcacatttacctcattggcaacccagtcatctggtggact
tctaccgccgcagttgtcatctgggtcctcttcaagggtattgccgttcttcgatggcag
cgtggcttcaaggactacaactgtgtccacttcaagcgcttcgattacgagattggccag
actcttctcggctgggctctccactacttcccattctacctcatggcccgccagcttttc
ctccaccactacctcccagccttgtactttgcaatcctggcattctgtcagatctacgac
tttgtggctaacagattcaacaagccatccatctttggcaagctgttcaccgttgcattc
ttgtctctcagcgttgctgccttctgtatcctttcaccgcttgcatacggcaacccttgg
accaaagacatgtgccagaggaccaagttgatccctacctgggactttgactgcaacctt
ttccataatgacctatcccaatatgctatccctgaagttatcagcacctcggaagccgct
catacttccatcgcagccccacccgtacagcagcagcagcagcagcagcaaccaggagag
caaaagcaggagcagcaacctgaacagcaggagaaccaagttcctgtccagcccgaatca
ccacaacagccaccggcagtggacccagagcttcgtaaagttcgtgaagtcgagtaccgc
gattcagagggcaacatcctcagcgaggaacaagtcaaagtcctccaggaacagggagaa
atctcctttgaaacccgatatgagactcgcactagactaatcgataccgaaggccgagaa
ctccccaaggaagctattatcgcccctgaacacccagacgtgcagggcgctaacccagaa
accgttgctaaggacgaaccaaaggctccagctaacaagccagctgaggtcaagggagag
aacgagtcccccaaaaagaaagaaaataagccaaagcccgccagcgaggctaaggctgct
acaaactaa

DBGET integrated database retrieval system