KEGG   Trichophyton verrucosum: TRV_02270Help
Entry
TRV_02270         CDS       T01615                                 

Definition
cytochrome P450 oxidoreductase OrdA-like, putative
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
tve  Trichophyton verrucosum
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:tve00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:tve00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1064 aa AA seqDB search
MSEPIPGPAPLPIVGNAYNLDLVNSFTTFGNLTDTYGPIFKLTLGGEEKIFITTQSLMDE
VCNEKRFSKLVAGSLAQIRNGVQDGLFTAHPGEHNWEIAHRVLMPAFGPLSIRAMFDEMH
DIASQLVIKWARFGPNEKIHVTDDFTRLTLDSIALCAMGTRFNSFYHEDMHPFVHAMVGF
LAESGARASRPAVVQYFMHSAQQQYDADIELMKKVAGDLVADRKANPNDKKDLLNAMLKG
KDARTGEHMTEDSIMNNMITFLIAGHETTSGLLSFLFYYLLKHPSAYQAAQRQVDEVVGR
GPITVEHMSKLPYIEACMRETLRLSPSAIAIQMQPRPDGQEDPIYLGKGKYEIKKGQAIV
CVIPQIHRDPTVYGDDANLFRPERMLDEPFAKLPKNSWKPFGNGVRGCIGRPFAWQETIL
TAAMLLQNFNLRFDDPSYQLQIKQTLTIKPKDFFMRATLRHNVDPVQLEKMLHVNIEAEA
KAGEKDRAAGISSVGPAKKPMTILYGSNAGTCEALAQNLARDASSRGYSAQVGPLDSGVD
KVPKDQPVIVISSSYEGQPPDNAAHFVEWIQGLGSGAMTGVEYAVYGCGNHDWTSTFHRI
PKLLDAEFKRCGATRVADVGLGDVADGDIFNHFDKWQDEQLWSSIGGDVDPAEEGTVEVD
IDTDARKSTLRQDVREATVISNKVLTAPGEPEKRHLILTLPTGMSYKSGDYLAVLPINDQ
RNIRRALNRYNLPWDAMLTIKVGANTTLPTGHPVSAMDVLSAYVELGQPATRKNVARIAS
SISDEKVREEVLALSKEGFENEILKKCRSPLDLLEEYPTAELPLGDFLAMLPPMRIRQYS
ISSSPLADPTVASITWSVLDAPSRVADSKRFLGVASNFLSKVQEGDRIHVAVKPSHGNFH
PPKDTENTPLMMFCAGTGLAPFHGFVQERAIQIQAGRKLAPAYLFIGCRHPERDALFKDE
LQKWETDGVVTVFYAFSAASEQSKHCRYVQDRLWEERGEMRKVFDQGAKLYVCGTSRVGE
GIASTVKKIFQDYCASVGKPKTDEEVERWFQDIKSDRFSSDVFA
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccgattcctgggccggcaccgttgcccattgtcgggaatgcttataacctt
gatcttgtaaactcctttaccacctttgggaacctcacagatacttatggaccaatcttc
aagcttaccctgggtggtgaggagaagatcttcatcaccactcagtccttgatggatgag
gtctgcaatgagaagcgattctcgaaactcgtcgctggcagtctggcccagatcagaaac
ggagtccaagacgggctcttcacagctcacccgggggaacacaactgggagattgcacat
cgtgttttgatgccagcgtttggtccattatcaattcgggccatgttcgatgagatgcat
gatattgcatcacagctagtgattaaatgggcgcggtttggtcccaacgagaagatacat
gtcacagatgatttcacgcggctgactcttgactctatcgccctatgtgccatggggacc
cgattcaactcattctatcatgaggatatgcacccctttgttcacgccatggttgggttc
ttggccgagtctggagccagagcaagtcggccagctgttgttcaatactttatgcactct
gcacaacaacaatatgatgccgatattgagctgatgaaaaaggtcgccggggacctggtt
gcggatcggaaagccaaccccaacgacaaaaaggacctgctcaatgccatgctcaagggg
aaggatgctagaaccggagaacatatgaccgaagatagtatcatgaacaatatgataacc
ttcttgattgccggccacgagacaaccagcggccttttgtcgttcttgttttattatctc
ttgaaacatccatcagcgtaccaagctgcgcagcgtcaggtggatgaagtcgtgggccgt
ggacctattactgtcgagcatatgtcgaagttgccttacatagaggcttgtatgcgtgaa
actctcagactttcaccttctgcaattgctatccaaatgcagccccggccagacggtcag
gaggatcctatttaccttggcaaggggaagtatgaaattaaaaagggccaggcaattgtt
tgcgtcatccctcaaatccatcgtgacccaacagtgtatggagacgatgccaacctcttc
aggccagaaaggatgctggatgaaccttttgctaagctccctaaaaattcctggaaacct
tttggtaatggtgtacgtggatgtattggaaggccatttgcatggcaggagaccatctta
actgctgcaatgctcctccagaacttcaacctgcgatttgacgacccaagctaccagctg
cagataaaacagacacttacaattaagcccaaggacttttttatgcgcgcgacgctaaga
cacaacgttgaccctgttcagctggagaagatgcttcatgtgaatatagaggcagaagct
aaggccggagagaaggacagggcagccggcatctcctctgttggaccggcaaagaaaccc
atgacaatactttacggctcaaatgcaggaacttgtgaggcgctggcacagaacttggct
agagatgcctcgagcagaggctatagtgcacaagttggccccttggattcgggtgttgac
aaagtacccaaggatcagccagtgatcgtcatatcgtccagttatgaagggcagccacca
gacaatgccgcacattttgtcgagtggatccaagggctcgggagtggtgcaatgaccgga
gtggaatacgcagtttatggctgcgggaatcatgattggacctcgacgtttcacagaata
ccaaaactcctggatgcagagttcaagaggtgcggtgcgactagagtcgctgatgttggc
cttggggacgtagcagatggggatatcttcaaccacttcgataaatggcaagacgagcag
ctttggtcctctatcggcggcgacgttgaccctgccgaagagggtaccgtggaagttgac
atcgatacagatgctcggaagtctaccctccgtcaggacgtgagagaagcaactgtcatc
agtaataaagtactgactgcacccggagaaccagagaagaggcaccttattttaacgctt
cctaccgggatgtcgtacaagtctggggattatcttgccgtacttcctataaacgaccag
aggaatatccgacgagccctgaaccgttacaacctcccgtgggacgcaatgttgacaatc
aaggttggtgctaatactaccttgccaacgggtcaccctgtttctgcaatggatgtattg
agtgcatatgtcgagctgggccaaccagcgacgagaaagaacgttgctcgaatcgcttcc
agtatatcggatgagaaggtccgtgaggaagtccttgctctttcaaaggaaggatttgaa
aacgagattttgaagaaatgccgctctccgttggatcttctcgaggaatatccaacagcc
gagctgcctcttggagacttccttgcaatgctgccaccaatgcgcattcgccaatattca
atttcctcctcgcccttggcagacccaacagttgcgtctattacttggtcagttctcgat
gcgccgtctcgggttgctgattcaaagaggttccttggtgtggcatccaacttcctttcc
aaagtccaggagggcgataggatccatgttgccgtgaagccaagccatggcaactttcac
cctcccaaggacaccgaaaacacacctctcatgatgttctgtgccgggactggccttgcc
cctttccacggttttgttcaagagagagccatccagatccaagcgggccgaaaattggca
cccgcgtaccttttcatcggatgcagacatcccgaaagagacgctctgttcaaggatgag
cttcagaaatgggagactgacggcgtagtgacggtgttttatgcattttccgcagcaagt
gagcaaagcaagcactgtcgatacgtccaagacaggctgtgggaggaaagaggtgagatg
agaaaggtctttgaccagggagcaaagctgtatgtttgcggcactagcagggttggagaa
ggcatcgcatctaccgtgaagaagatattccaggactattgcgcctctgttggcaagcca
aagacggacgaagaggtagagcgctggttccaggatatcaagagcgaccggttttcctcg
gacgtcttcgcataa

DBGET integrated database retrieval system