KEGG   Trichophyton verrucosum: TRV_02270Help
Entry
TRV_02270         CDS       T01615                                 

Definition
cytochrome P450 oxidoreductase OrdA-like, putative
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
tve  Trichophyton verrucosum
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    TRV_02270
  Amino acid metabolism
   00380 Tryptophan metabolism
    TRV_02270
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     TRV_02270
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     TRV_02270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1064 aa AA seqDB search
MSEPIPGPAPLPIVGNAYNLDLVNSFTTFGNLTDTYGPIFKLTLGGEEKIFITTQSLMDE
VCNEKRFSKLVAGSLAQIRNGVQDGLFTAHPGEHNWEIAHRVLMPAFGPLSIRAMFDEMH
DIASQLVIKWARFGPNEKIHVTDDFTRLTLDSIALCAMGTRFNSFYHEDMHPFVHAMVGF
LAESGARASRPAVVQYFMHSAQQQYDADIELMKKVAGDLVADRKANPNDKKDLLNAMLKG
KDARTGEHMTEDSIMNNMITFLIAGHETTSGLLSFLFYYLLKHPSAYQAAQRQVDEVVGR
GPITVEHMSKLPYIEACMRETLRLSPSAIAIQMQPRPDGQEDPIYLGKGKYEIKKGQAIV
CVIPQIHRDPTVYGDDANLFRPERMLDEPFAKLPKNSWKPFGNGVRGCIGRPFAWQETIL
TAAMLLQNFNLRFDDPSYQLQIKQTLTIKPKDFFMRATLRHNVDPVQLEKMLHVNIEAEA
KAGEKDRAAGISSVGPAKKPMTILYGSNAGTCEALAQNLARDASSRGYSAQVGPLDSGVD
KVPKDQPVIVISSSYEGQPPDNAAHFVEWIQGLGSGAMTGVEYAVYGCGNHDWTSTFHRI
PKLLDAEFKRCGATRVADVGLGDVADGDIFNHFDKWQDEQLWSSIGGDVDPAEEGTVEVD
IDTDARKSTLRQDVREATVISNKVLTAPGEPEKRHLILTLPTGMSYKSGDYLAVLPINDQ
RNIRRALNRYNLPWDAMLTIKVGANTTLPTGHPVSAMDVLSAYVELGQPATRKNVARIAS
SISDEKVREEVLALSKEGFENEILKKCRSPLDLLEEYPTAELPLGDFLAMLPPMRIRQYS
ISSSPLADPTVASITWSVLDAPSRVADSKRFLGVASNFLSKVQEGDRIHVAVKPSHGNFH
PPKDTENTPLMMFCAGTGLAPFHGFVQERAIQIQAGRKLAPAYLFIGCRHPERDALFKDE
LQKWETDGVVTVFYAFSAASEQSKHCRYVQDRLWEERGEMRKVFDQGAKLYVCGTSRVGE
GIASTVKKIFQDYCASVGKPKTDEEVERWFQDIKSDRFSSDVFA
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccgattcctgggccggcaccgttgcccattgtcgggaatgcttataacctt
gatcttgtaaactcctttaccacctttgggaacctcacagatacttatggaccaatcttc
aagcttaccctgggtggtgaggagaagatcttcatcaccactcagtccttgatggatgag
gtctgcaatgagaagcgattctcgaaactcgtcgctggcagtctggcccagatcagaaac
ggagtccaagacgggctcttcacagctcacccgggggaacacaactgggagattgcacat
cgtgttttgatgccagcgtttggtccattatcaattcgggccatgttcgatgagatgcat
gatattgcatcacagctagtgattaaatgggcgcggtttggtcccaacgagaagatacat
gtcacagatgatttcacgcggctgactcttgactctatcgccctatgtgccatggggacc
cgattcaactcattctatcatgaggatatgcacccctttgttcacgccatggttgggttc
ttggccgagtctggagccagagcaagtcggccagctgttgttcaatactttatgcactct
gcacaacaacaatatgatgccgatattgagctgatgaaaaaggtcgccggggacctggtt
gcggatcggaaagccaaccccaacgacaaaaaggacctgctcaatgccatgctcaagggg
aaggatgctagaaccggagaacatatgaccgaagatagtatcatgaacaatatgataacc
ttcttgattgccggccacgagacaaccagcggccttttgtcgttcttgttttattatctc
ttgaaacatccatcagcgtaccaagctgcgcagcgtcaggtggatgaagtcgtgggccgt
ggacctattactgtcgagcatatgtcgaagttgccttacatagaggcttgtatgcgtgaa
actctcagactttcaccttctgcaattgctatccaaatgcagccccggccagacggtcag
gaggatcctatttaccttggcaaggggaagtatgaaattaaaaagggccaggcaattgtt
tgcgtcatccctcaaatccatcgtgacccaacagtgtatggagacgatgccaacctcttc
aggccagaaaggatgctggatgaaccttttgctaagctccctaaaaattcctggaaacct
tttggtaatggtgtacgtggatgtattggaaggccatttgcatggcaggagaccatctta
actgctgcaatgctcctccagaacttcaacctgcgatttgacgacccaagctaccagctg
cagataaaacagacacttacaattaagcccaaggacttttttatgcgcgcgacgctaaga
cacaacgttgaccctgttcagctggagaagatgcttcatgtgaatatagaggcagaagct
aaggccggagagaaggacagggcagccggcatctcctctgttggaccggcaaagaaaccc
atgacaatactttacggctcaaatgcaggaacttgtgaggcgctggcacagaacttggct
agagatgcctcgagcagaggctatagtgcacaagttggccccttggattcgggtgttgac
aaagtacccaaggatcagccagtgatcgtcatatcgtccagttatgaagggcagccacca
gacaatgccgcacattttgtcgagtggatccaagggctcgggagtggtgcaatgaccgga
gtggaatacgcagtttatggctgcgggaatcatgattggacctcgacgtttcacagaata
ccaaaactcctggatgcagagttcaagaggtgcggtgcgactagagtcgctgatgttggc
cttggggacgtagcagatggggatatcttcaaccacttcgataaatggcaagacgagcag
ctttggtcctctatcggcggcgacgttgaccctgccgaagagggtaccgtggaagttgac
atcgatacagatgctcggaagtctaccctccgtcaggacgtgagagaagcaactgtcatc
agtaataaagtactgactgcacccggagaaccagagaagaggcaccttattttaacgctt
cctaccgggatgtcgtacaagtctggggattatcttgccgtacttcctataaacgaccag
aggaatatccgacgagccctgaaccgttacaacctcccgtgggacgcaatgttgacaatc
aaggttggtgctaatactaccttgccaacgggtcaccctgtttctgcaatggatgtattg
agtgcatatgtcgagctgggccaaccagcgacgagaaagaacgttgctcgaatcgcttcc
agtatatcggatgagaaggtccgtgaggaagtccttgctctttcaaaggaaggatttgaa
aacgagattttgaagaaatgccgctctccgttggatcttctcgaggaatatccaacagcc
gagctgcctcttggagacttccttgcaatgctgccaccaatgcgcattcgccaatattca
atttcctcctcgcccttggcagacccaacagttgcgtctattacttggtcagttctcgat
gcgccgtctcgggttgctgattcaaagaggttccttggtgtggcatccaacttcctttcc
aaagtccaggagggcgataggatccatgttgccgtgaagccaagccatggcaactttcac
cctcccaaggacaccgaaaacacacctctcatgatgttctgtgccgggactggccttgcc
cctttccacggttttgttcaagagagagccatccagatccaagcgggccgaaaattggca
cccgcgtaccttttcatcggatgcagacatcccgaaagagacgctctgttcaaggatgag
cttcagaaatgggagactgacggcgtagtgacggtgttttatgcattttccgcagcaagt
gagcaaagcaagcactgtcgatacgtccaagacaggctgtgggaggaaagaggtgagatg
agaaaggtctttgaccagggagcaaagctgtatgtttgcggcactagcagggttggagaa
ggcatcgcatctaccgtgaagaagatattccaggactattgcgcctctgttggcaagcca
aagacggacgaagaggtagagcgctggttccaggatatcaagagcgaccggttttcctcg
gacgtcttcgcataa

DBGET integrated database retrieval system