KEGG   Trichophyton verrucosum: TRV_02306Help
Entry
TRV_02306         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
tve  Trichophyton verrucosum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tve00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    TRV_02306
Enzymes [BR:tve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TRV_02306
Peptidases [BR:tve01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TRV_02306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1074 aa AA seqDB search
MVEPAEPIWGAGDGAPVPGAGRPPYPSMKELQNMAACLNLGEDPSLNELLHISEDAISRS
KTLAQRGKYDSALVYYLRASDITVNMIPRHPDFTYMKQNHPRWADQFARLMMLVDSQHKT
MEDIKRKITESNNAAGHSRSTSTPSSAPLRMPSPTNFHRQPLNTTSHSSAGSRPASESIP
AQDPLAQRLAGLRNHRHQGSSPSNEGTNGSSYSTISPNGNYSTYRSQLHSQAHSGQRSPV
PSKPLGPREMNPSVPTVPPKVPISGVDAPPPRYPSPAYNPMWTVPSIPTPNPPRTSVESI
RNTIYKQTNTGATNSNSSLNTSTDNPYRSQTPNGIRPEADSGNRSPDIYVGPTITATKLV
EYIRKYDVLLIDVRSRDQYDAGHIYAKSILCIEPVVLKENISAEELEDRLIISPDTEQSL
FNRRNEFDLIVYYDQSTVEPTYLIGSPAGSAVPHLRALYDTLYEFNFYKPLKGGRPPALL
VGGLDAWVDLVGPQSLATSQTSAILSSVRARRQAPDSSQPLRRNPTVSANSSWEVRKRRL
RDYKPLNPEEERAWLEKAKDEEIDTSYVAEEGDITEEPEDIDGSTLRQTASFVHSYEDFL
RRFPEPNDIRESMVHAGNAVQFPLYDAAAVPAPSRPPPAIPRPSYSGVADRGQTQPPLAR
QSSAHKQALYSSPIDRLRLPRTGLINLGSTCYMNSIIQSLSATVLLTKFFVDNRFHAQVQ
KNWKGSQGVLPGLFANLIRSLWKNDVEVIRPTSFRKFVGRLNTEWAGSQQQDAKEFFDVL
VDCLHEDLNLRWQRTPLRPLTFAEEMRREQMPIHKVSEIEWARYSHRELSYVSSLFAGQH
ASRLRCTTCRKTSTTYEAFYSISVEIPVTGTGDIYQCLKSYCQEEVLSGDEVWKCPYCKR
EREAAKQIILTRAPRFLVFHFKRFSASRRQQARKIHTPVSFPLSGLDMTPFMIQHPQHSQ
SSRPVSPLPDGNDDKLDSKSNSHAPPKSQSALQTNELATSSPYIYNAYAVVRHIGSTMNE
GHYISLVRDEQRRCWRKFDDQRVTDFQPSSSRSSPDNLQNEQAYLVFYERAPAN
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaccagcggagccgatttggggtgctggagatggagctcccgtcccaggtgcg
ggtaggcctccctatccctcgatgaaagaattgcaaaacatggcagcttgtttgaacttg
ggtgaagatccatcgttaaatgagctattacatatctccgaagatgccatcagcaggtcc
aaaaccctcgcccagcgagggaaatatgattctgctctcgtctattacctccgtgcctct
gatatcactgtcaatatgattccccgccacccagatttcacgtatatgaagcagaatcac
ccaagatgggcggaccagtttgccaggctcatgatgctcgttgattcgcagcacaagacg
atggaagacattaagcggaaaatcacagaaagcaacaacgccgcaggacactcacgctcg
acgtcaactccatcttctgctcctctacgcatgccaagccccaccaactttcacaggcag
ccattaaacaccacttcgcatagctcagcaggcagcaggcctgccagtgagtcgatacct
gcgcaggatccccttgctcagagacttgcaggcttgagaaaccatcgacatcaaggcagc
agcccatcgaacgagggaacaaacggctcttcctactctaccatcagccccaatgggaat
tactctacctaccggtcacaactacactcacaggctcattcaggacagcgcagtcctgtg
ccttcgaaaccactggggccccgagagatgaacccatctgtcccgactgtccctccaaag
gtccccatctctggtgtagatgcacctccccccagatacccaagccctgcctataaccct
atgtggacagtgccctcgataccaactccgaaccctcctaggacatccgtcgaaagcata
cgcaatactatctacaaacagacaaacaccggagcaacaaattccaacagcagccttaac
acctctacagataacccgtaccgctcgcaaactccaaacgggatccgccccgaggctgat
tctggaaacagaagcccggacatctatgttggccctacgattactgctacaaagctggta
gaatacattcgaaaatatgatgtcctgctcatcgacgttcggtcacgagatcaatatgat
gccggtcacatatatgccaagtccatcttgtgcattgagccagtagtgttgaaggagaac
atatctgcagaagagcttgaggatcggctgattatctcacccgacacagaacagtcatta
ttcaacaggcgaaacgaatttgaccttatcgtctactatgaccaaagcaccgttgagcca
acatatttgatagggtctcccgctggaagtgcagttccacatctgcgcgctctctatgat
actttatatgagttcaacttttataagccgttaaaaggtggccgacctccagctctttta
gttggtggtctagatgcatgggttgacttggtcgggccacaatctctagcgacgtcccaa
accagcgcgatactaagctctgtccgtgctagaagacaagcgcctgattccagccagcct
ttgcgcagaaatcctactgttagcgcaaattcaagctgggaggtgagaaagaggaggctg
cgtgattataagcctcttaaccctgaagaagaacgagcctggctcgaaaaggcgaaggac
gaggagatagacaccagctacgttgctgaggagggggacattactgaagaaccagaagat
atcgacggatccactctacggcagacagcatcattcgtacatagttacgaggactttctt
aggaggttccctgagccaaacgacattcgagagtctatggtacatgcgggaaatgcagta
caatttccactgtacgacgctgcagccgtaccagctccgtcgaggccaccacccgccatt
cctcgacccagctatagtggtgtggcagaccgtggtcagacgcaacctccgcttgctcgg
caatcatccgcccataaacaagcgctatactcttcccccatagatcgactgaggctccct
cggactggccttatcaacctgggctcaacctgttatatgaattcaataatacaaagtctt
agcgctactgtcctccttaccaaattttttgtcgataatcgctttcacgctcaagttcaa
aagaactggaaaggctcgcaaggcgtcttgccgggcttgttcgcaaatctgatacggtct
ttgtggaagaatgacgttgaagtaattcggcctacatcattccggaaatttgttggtcga
ttgaacacagagtgggcaggaagccagcagcaagacgcaaaggagttctttgatgtgtta
gttgattgtttacatgaggatctcaatctacgttggcaacgcacgcctttacggccattg
acctttgcagaggaaatgcgccgagaacaaatgccaatccacaaggtatcggaaatcgaa
tgggcccgatactcgcaccgtgaactatcgtatgtatcctcccttttcgcgggacagcat
gccagtcgacttcgctgcaccacatgccgaaagacctccacgacatacgaggcattttat
agcattagtgtcgaaatccccgtcacaggaactggagatatttatcaatgcctcaaaagc
tactgtcaagaggaagtactcagtggtgacgaagtttggaaatgtccatactgcaaacga
gagcgagaagccgcaaaacaaatcatcctcactcgagctcctcgcttcctcgtctttcat
ttcaagagattttccgcctccagacggcaacaggcgcgtaaaatccacacaccggtttct
ttcccgcttagcggcctcgacatgaccccctttatgattcaacatcctcaacattcccaa
tcttctcgtcccgtctctcctctgccggatggcaatgacgataaactcgattcgaaatca
aactcacatgcccccccaaaatcccaatcagcgctacagactaatgagctcgctacgtct
agtccatacatttataacgcctacgccgttgtccggcacattggttcaactatgaatgaa
ggacattacatctcattggttagagatgagcaacgcagatgttggcggaaatttgatgat
caacgagtaacggatttccaaccaagttcttcccgttcttcccctgacaacttgcaaaac
gagcaggcataccttgttttttatgagcgggccccagctaactaa

DBGET integrated database retrieval system