KEGG   Trichophyton verrucosum: TRV_02393Help
Entry
TRV_02393         CDS       T01615                                 

Definition
MAP kinase MpkC
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
tve  Trichophyton verrucosum
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:tve04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 243 aa AA seqDB search
MAEFVRAQIFGTTFEITTSSAKDQLTNQAVAVKKIMKPFSTPVLAKRTYRELKLLKHLRH
ENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQYFLYQILRGLKYVHSAG
VVHRDLKPSNILINENCDLKICDFGLARVQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVD
VWSAGCIFAEMLTGRPLFPGKDHVNQFSIITELLGTPPDEVIQTIGSANVGAFSLYFNFS
STF
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcggagttcgtgcgcgcccagatattcggcaccaccttcgaaatcaccaccagctcc
gccaaagaccaattgacaaaccaggccgtcgccgtcaagaagatcatgaagccgttcagc
acgcctgtcctggccaagcggacctaccgagagctcaagctgctcaagcacctgcgacat
gaaaatgtcatcagcttaagcgacatcttcatctcgccgctcgaagacatatacttcgtc
acagagctgctcggcaccgacctccacagactgctcacctcccggcccctagaaaagcag
ttcatacagtactttctctaccagatcctcagaggcctcaagtatgtacattccgccggc
gtcgtccaccgagacctcaaaccaagcaacatcctcatcaacgaaaactgcgacctcaag
atctgcgactttggcctcgcccgtgtccaggacccccagatgaccggctacgtctcgacg
cgctactaccgtgcccccgagatcatgctgacatggcaaaagtacgacgtcgaggtcgat
gtctggagtgcggggtgcatcttcgccgagatgctgactggtcgaccgctcttcccgggc
aaggatcatgtcaaccagttctccatcatcaccgagctgctcgggacgccaccagacgag
gtcatccagactatcggttctgccaacgtgggtgccttttctctctatttcaacttttct
tctacattctag

DBGET integrated database retrieval system