KEGG   Trichophyton verrucosum: TRV_02417Help
Entry
TRV_02417         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
tve  Trichophyton verrucosum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 264 aa AA seqDB search
MAETDTAEIQYIDGVKTLVPLGIISTIFAVSGVTNFQMCPAITSLASDLGFYDVYSIDDP
DLLAFIPRPVYGLIFICPRDAYYRTRESMGTDNMPEYTGSGPDEPVLWFRQTIKNTCGLM
ALIHCISNGDAREYIPAGSELDQLFKTAVDLAPTERAQLLYDSPLLERAHRSAARRGDST
VPAPDDKCGFHYICFVKGSDGHLWDLEGGVKGPIDRGLLEEGQDGLSEKALELGVRTFLK
HQSDTGKGVDVSGFSIVALAPSMD
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcagagacagacacagcggagattcagtatatcgatggagtcaagactctagttccc
ctaggtattatctctaccatctttgctgtctctggcgtcacgaacttccaaatgtgccct
gctattaccagtttagcttccgacctggggttctatgatgtctacagcatcgatgaccca
gacctgctggcgttcatcccgcggccagtttacggccttatcttcatctgtccccgcgat
gcatactaccgtactcgcgagagtatgggcacagacaacatgcccgagtacacgggctcg
ggaccagacgagcccgtcctgtggttcaggcagaccattaaaaatacctgtggtctgatg
gctctgattcactgcatcagcaacggggacgcaagggaatatatccccgcaggatctgaa
ctggatcaactgttcaagacagccgtggacctggctcctacggagcgtgctcagttgctg
tacgattcacccttgctggaacgagcacatcgctcagctgcgagacgaggggacagcact
gttccggctcctgatgacaagtgtggttttcattatatctgcttcgtcaaggggtcagac
ggccacctgtgggatttggagggcggggtgaagggccctatcgatcgagggctgctggag
gagggccaggatgggttgagtgaaaaggctctcgagcttggggttcgaacgttcctcaag
catcaaagcgataccgggaagggagtcgacgtatctggcttcagcattgtggccctagca
ccgagcatggattga

DBGET integrated database retrieval system