KEGG   Trichophyton verrucosum: TRV_02424Help
Entry
TRV_02424         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tve  Trichophyton verrucosum
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:tve04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 411 aa AA seqDB search
MATTKMIKQLLPDIAHAKEQQQQQQQQVLEHDHVEAEVKPDRLSWPASRPRTPKDVVQAR
LKQDAGLPDNGLTIDDFDLIKTLGTGTFARVWFARLKAAKEPNKNIFALKILRKAEGRLP
DPSPNYLRSVIKLKQVEHVRNESKCLSKAAGHPFITTLITTFSDEQCLYMLLEYCPGGEI
FSFLRRARRFDEYTSKFYAAEITLVIGYLHDMHGIAYRDLKPENILLDQEGHLKLVDFGF
AKQLYNLETYTLCGTPEYLAPEVIHNSGHGLAVDWWALGILIYEFIVGQPPFWDSNPMGI
YEKIVAGCIRFPANMPASAKDIISALCKVNPSERLGHISGGSQRVRDHPFFEGIDWDDLY
RKRVKGPIVPQVSHPADTANFEEYPDPPDPATQAVYTDEMKARYEEIFQDF
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaacaaagatgataaaacagctgttgcctgacatagcacatgcgaaggagcag
cagcagcagcagcagcagcaggtactggagcatgaccatgtagaggctgaggtcaagccg
gaccgtctctcatggccggcatcgcggcctaggacgcccaaggacgttgttcaagcccgg
ctgaagcaggatgccggtttgcccgataacggacttacaattgacgactttgatctcatc
aagacccttgggacgggcacctttgctcgggtatggtttgccaggttaaaggctgccaaa
gaacccaacaagaacatctttgctctgaagatactcaggaaagccgaaggtagactaccc
gatccctcccccaactacttaagaagcgtaataaagctgaaacaagtcgaacatgtacga
aacgaaagcaagtgcctctccaaggctgccggtcatccttttataacgacgctaatcacc
accttttcggatgaacaatgcctctatatgctgcttgaatactgccctggcggcgaaata
ttcagcttcctccgacgagcccgcagattcgacgaatacacttctaaattctacgccgct
gaaataacattagtgatcgggtacctgcatgacatgcatggaatagcctaccgcgacctc
aagcccgaaaacatcctcctcgaccaggaaggccatctcaaactagtcgactttggcttc
gcaaaacagctatataacctcgagacctacaccctctgcggcacaccggaataccttgct
cctgaagtcatacataacagcggccatggccttgcagttgactggtgggccctgggaatc
ctcatctacgagtttatagtcggtcaaccgcccttctgggactcaaacccaatggggata
tacgaaaagatagttgcaggatgcatccgttttcccgcgaacatgcctgcctcagctaag
gatataattagtgctctttgcaaggtcaatccgtccgaacgactgggccatatatccgga
ggcagccagcgggttagggaccatccgttctttgaaggcatcgattgggacgacttatac
cgcaagcgggttaaggggccaattgtgccgcaggtgagccatcctgcagatacggcgaat
ttcgaagagtatccggaccctccggacccagccacacaggcggtgtataccgatgagatg
aaggcacggtatgaagagatattccaggacttttaa

DBGET integrated database retrieval system