KEGG   Trichophyton verrucosum: TRV_02602Help
Entry
TRV_02602         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tve  Trichophyton verrucosum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tve01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tve00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:tve00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 544 aa AA seqDB search
MAATASQKYLSSRGGSYGFSFEEVVLKGLASDGGLFIPEQIPSLPTDWETKWRNYSFQEL
AFEILSLYISPSEVPSDDLKDIISRSYGTFSGYLADANGLNRSPDITPLVTLDEQKRLYL
LELFCGPTFAFKDVALQFLGNLFEYFLVRRNEGKTGKDRHHLVVIGATSGDTGSAAIYGL
RGKKDASVFILHPKGKVSPIQEAQMTTVLDENVHNISIEGSFDDCQDMVKALFADPEINK
THKLAAVNSINWARILAQITYYFHSYFSLIRSPTYVNGKPIRFVVPSGNFGDILAGWFGK
QMGLPVDKLVIATNENDILDRFLKTGQYTKQAQPEAQASASAVKETWSPAMDILVSSNFE
RLLWFLAYKVYGQGDIDEQRKIAGNTVLSWLQDLSGKGGFGVDEKILQAAQQEFESERVS
NEQTIDTIRSIYSTCFPQTPVSAGTRGETGGYILDPHSAIGVAASLRSISRCAETFHISL
STAHPAKFAEAVDAALRNEKGYSFDNVLPPEFVGLEKKERRVISMPAGATWKSVGEVINQ
NVAV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggctgctacggcgtcgcagaagtacttgagctctcggggtggctcgtacgggttttcc
tttgaagaagtcgtcctgaagggactggcatcagacggaggcctctttatcccggaacag
atcccttcactgccgacggactgggagacaaagtggcgcaactatagcttccaggagttg
gcctttgagatcctatcattgtacatctccccttcggaggttccatcagatgacttgaag
gacataatatctcgcagctacgggacattcagtggctatcttgctgatgcgaatgggttg
aacaggtctcccgatatcaccccactggtcacattggacgagcagaagcggttatatctt
ttggagctgttctgcgggcctacatttgcctttaaagatgtggcattgcaattcttggga
aacctatttgaatacttcctcgtgagacggaatgagggcaagaccggaaaggaccgtcac
catcttgtggttattggagctacgagtggagacaccggctcagctgccatatatgggcta
cgtgggaagaaggacgcctccgtcttcatcctgcatccaaagggcaaagtgtctccaatc
caggaagctcagatgacaactgtgttagatgaaaatgtccataacatcagtattgaagga
tctttcgacgattgtcaggatatggttaaggctctttttgccgaccctgaaatcaacaaa
acccacaagctagctgctgtgaactcgataaattgggcccgaattcttgctcaaatcact
tactacttccattcttatttctccctcattcgatctcccacctacgtcaatggaaagcct
attcgatttgtcgtgccatcaggtaactttggagatatactggctggctggtttggaaag
caaatgggcctgccagtcgataaactggttattgccaccaacgagaatgacatccttgac
aggttcttgaaaactggccagtacacgaaacaagcacagcctgaggcgcaagccagcgca
tctgctgtaaaagaaacttggagtcctgctatggacattctggtatcaagcaattttgag
cggcttctctggttccttgcttacaaagtatacggtcaaggagatatcgacgagcagcgg
aaaatcgctggcaatacggttctcagctggcttcaggatctctctggcaagggaggattt
ggagttgatgagaagattctccaggcagctcagcaagagttcgagagtgagcgggtatct
aatgagcaaacgatcgacactattcgatccatttactcgacttgcttcccacaaacccct
gtcagcgctggcaccagaggagaaacggggggatacatccttgacccccattccgcgatt
ggagttgcagcatcgttgagatcgatatctcggtgcgcagagacctttcacatatcattg
tcgaccgcacatccagccaaatttgctgaagcggtggatgcggctctgcgaaacgaaaag
gggtattcgtttgacaacgtgcttcctccagagttcgttggcctagagaagaaggaacga
cgtgttatttccatgccggctggtgctacttggaaatcggttggcgaagtcatcaaccag
aacgttgctgtttag

DBGET integrated database retrieval system