KEGG   Trichophyton verrucosum: TRV_02602Help
Entry
TRV_02602         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tve  Trichophyton verrucosum
Pathway
tve00260  Glycine, serine and threonine metabolism
tve00750  Vitamin B6 metabolism
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
tve01230  Biosynthesis of amino acids
Module
tve_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TRV_02602
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TRV_02602
Enzymes [BR:tve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TRV_02602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 9583276
NCBI-ProteinID: XP_003023268
UniProt: D4D679
AA seq 544 aa AA seqDB search
MAATASQKYLSSRGGSYGFSFEEVVLKGLASDGGLFIPEQIPSLPTDWETKWRNYSFQEL
AFEILSLYISPSEVPSDDLKDIISRSYGTFSGYLADANGLNRSPDITPLVTLDEQKRLYL
LELFCGPTFAFKDVALQFLGNLFEYFLVRRNEGKTGKDRHHLVVIGATSGDTGSAAIYGL
RGKKDASVFILHPKGKVSPIQEAQMTTVLDENVHNISIEGSFDDCQDMVKALFADPEINK
THKLAAVNSINWARILAQITYYFHSYFSLIRSPTYVNGKPIRFVVPSGNFGDILAGWFGK
QMGLPVDKLVIATNENDILDRFLKTGQYTKQAQPEAQASASAVKETWSPAMDILVSSNFE
RLLWFLAYKVYGQGDIDEQRKIAGNTVLSWLQDLSGKGGFGVDEKILQAAQQEFESERVS
NEQTIDTIRSIYSTCFPQTPVSAGTRGETGGYILDPHSAIGVAASLRSISRCAETFHISL
STAHPAKFAEAVDAALRNEKGYSFDNVLPPEFVGLEKKERRVISMPAGATWKSVGEVINQ
NVAV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggctgctacggcgtcgcagaagtacttgagctctcggggtggctcgtacgggttttcc
tttgaagaagtcgtcctgaagggactggcatcagacggaggcctctttatcccggaacag
atcccttcactgccgacggactgggagacaaagtggcgcaactatagcttccaggagttg
gcctttgagatcctatcattgtacatctccccttcggaggttccatcagatgacttgaag
gacataatatctcgcagctacgggacattcagtggctatcttgctgatgcgaatgggttg
aacaggtctcccgatatcaccccactggtcacattggacgagcagaagcggttatatctt
ttggagctgttctgcgggcctacatttgcctttaaagatgtggcattgcaattcttggga
aacctatttgaatacttcctcgtgagacggaatgagggcaagaccggaaaggaccgtcac
catcttgtggttattggagctacgagtggagacaccggctcagctgccatatatgggcta
cgtgggaagaaggacgcctccgtcttcatcctgcatccaaagggcaaagtgtctccaatc
caggaagctcagatgacaactgtgttagatgaaaatgtccataacatcagtattgaagga
tctttcgacgattgtcaggatatggttaaggctctttttgccgaccctgaaatcaacaaa
acccacaagctagctgctgtgaactcgataaattgggcccgaattcttgctcaaatcact
tactacttccattcttatttctccctcattcgatctcccacctacgtcaatggaaagcct
attcgatttgtcgtgccatcaggtaactttggagatatactggctggctggtttggaaag
caaatgggcctgccagtcgataaactggttattgccaccaacgagaatgacatccttgac
aggttcttgaaaactggccagtacacgaaacaagcacagcctgaggcgcaagccagcgca
tctgctgtaaaagaaacttggagtcctgctatggacattctggtatcaagcaattttgag
cggcttctctggttccttgcttacaaagtatacggtcaaggagatatcgacgagcagcgg
aaaatcgctggcaatacggttctcagctggcttcaggatctctctggcaagggaggattt
ggagttgatgagaagattctccaggcagctcagcaagagttcgagagtgagcgggtatct
aatgagcaaacgatcgacactattcgatccatttactcgacttgcttcccacaaacccct
gtcagcgctggcaccagaggagaaacggggggatacatccttgacccccattccgcgatt
ggagttgcagcatcgttgagatcgatatctcggtgcgcagagacctttcacatatcattg
tcgaccgcacatccagccaaatttgctgaagcggtggatgcggctctgcgaaacgaaaag
gggtattcgtttgacaacgtgcttcctccagagttcgttggcctagagaagaaggaacga
cgtgttatttccatgccggctggtgctacttggaaatcggttggcgaagtcatcaaccag
aacgttgctgtttag

DBGET integrated database retrieval system