KEGG   Trichophyton verrucosum: TRV_02738Help
Entry
TRV_02738         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
tve  Trichophyton verrucosum
Pathway
tve00600  Sphingolipid metabolism
tve01100  Metabolic pathways
Module
tve_M00094  Ceramide biosynthesis
tve_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TRV_02738
Enzymes [BR:tve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     TRV_02738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 9583150
NCBI-ProteinID: XP_003023117
UniProt: D4D6L1
AA seq 429 aa AA seqDB search
MKDDSKTPLVAGGHAELTQQKVANGSSPFCKPHSKRKRARSWLRRVKDVCLKHTWVLPLA
LLAILLAAYAVNPTESNPIHYGIFLSYPLPPETPGGPVLYGKGKLDIAFVAFYTIALSFT
REFLMQCVIRPWALYAGIKGRSKITRFMEQVYTAMYFSVFGPYGLYVMKQTNIWYFNTTA
MFENFPHKSHTADFKAYYLLEAAYWAQQGIVLLLKLEKPRRDFKELVGHHIITLALIALS
YRFHFTYIGLAVYITHDISDFFLATSKTLNYLDSPIITPFFALFVAVWVYMRHYLNLHIL
WAVLTEFRTVGPFELNWETEQYKFWVSQYITFGLLGSLQAINLFWLYLIIRIAKTYVFGN
ALQDERSDNEEEDDEIEESSTTGEANGVPIPTLLVNGHATKENIDPIENGSSTGLLTNGN
SNGAATKRK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgactcgaagacgcctctcgtggctggtggtcatgcagagctcacccagcag
aaggtagctaacggctcgagtcccttttgcaagccgcactcgaagcgaaagagagccagg
tcgtggctccgccgggtcaaagacgtctgcttaaaacacacctgggtcctgcctctcgct
ctcctcgccattctcctcgccgcatacgccgtcaacccgacagaatccaacccgatacac
tatggcatattcctctcctatccgttgcctccggagacaccgggcggcccagtactgtac
ggcaaggggaagctcgatatcgcctttgtggcattctacaccattgcgctctcgtttacc
cgtgagttcttgatgcaatgcgttattcggccgtgggctctatatgccgggatcaagggc
cgttcgaagatcacccggttcatggaacaggtgtatacggccatgtactttagtgtcttc
gggccgtatgggttatatgtcatgaagcagacgaacatctggtacttcaacactacggcc
atgtttgagaatttcccgcataaatcgcatactgcggatttcaaggcatattacctcctc
gaagccgcatattgggctcagcaaggaattgtgctgctgcttaaactagagaaacctagg
agagactttaaggagttggttgggcatcatatcatcactctcgcactcattgcgctgagc
taccggttccacttcacctatatcggtctcgccgtctacatcacacatgacatttctgac
tttttccttgctacgtcgaaaacgctcaattatctagactcgccgatcatcaccccattc
ttcgcccttttcgttgccgtctgggtttacatgaggcactaccttaacctccacattctc
tgggccgtcttgacagaattccgaaccgttgggcctttcgaactcaactgggagactgaa
cagtacaagttctgggttagccagtacatcacatttggtctcctgggttctcttcaggct
atcaatctattctggctctaccttatcatccgcattgccaaaacctatgtctttggaaac
gcactgcaagacgagcgaagtgataacgaagaagaagacgacgagattgaagaatcaagt
acgaccggcgaggcgaatggagttcccattccaacccttctcgtcaacggccatgctacg
aaagagaacatcgatccaattgagaacggatcatctacaggattattgacgaatggaaat
tcaaacggtgccgccacgaaacgcaaatga

DBGET integrated database retrieval system