KEGG   Trichophyton verrucosum: TRV_02785Help
Entry
TRV_02785         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
tve  Trichophyton verrucosum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tve00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TRV_02785
Translation factors [BR:tve03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    TRV_02785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 420 aa AA seqDB search
MTLRWAGKKSDRKEKAEKKKKKKRTTELRTHAKRTEKTESERGRLDIDQVVTFRLSIQEI
LDLRYPANNQPVRQPTPPPRTPQTPSTTASDQRPPRNRREKAISTRIKKKQSLAIMPPSK
WGFSRVDVLASTSATLSYMKHEHLAWLNLRKSEDEESTPPSSPPPVAAVARRKFDDEEDS
DDVLDDWEAAEDSEVEREKAQKAAAAKAKAEAEALANKKSRSQRIAEHQAAAARRRAEQE
SEEESDSEEDLAAKREKLRRTEQDADLKHAEDLFGDIDLNRTRNRTAPSKSVISDANDPT
KSIDLASIPLFKPSTKLQFTALTNALVPLLTAQAKNPAYTLWLQDFTKQLVKDLPSQEIK
KIASAMTAASNEKLKEEKAADKSGKKTKAAKTKTSLVATRGADLNAYDDVGDDLGDDDFM
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcgttgggcaggaaaaaaaagcgacagaaaagaaaaagcagaaaaaaaaaag
aagaagaaaaggacgacggaacttcgcacacacgcgaaacgcacagagaagacagagagc
gagcgaggacgtcttgacatcgatcaggtagtcacctttcggttaagcatccaagagatt
ctcgatttgcgatatccagcgaacaaccagccagtgcgccagccaactcccccaccacga
acaccccagactccgtcgaccaccgccagcgaccaacgaccaccacggaatagaagagag
aaagcgatatcaactagaatcaagaagaaacaaagcctagcaatcatgccgccgtcaaag
tgggggttctctcgcgtggatgtgttggcaagcacatcagctacattatcatacatgaag
cacgaacaccttgcttggttaaacctccggaagagcgaagatgaagagagtacgcctcca
tcatcaccaccaccagtagctgccgttgcgcgccgcaagtttgatgacgaagaagacagt
gacgatgttctcgatgactgggaggctgccgaggacagcgaagttgagcgtgagaaggcc
cagaaggccgctgctgccaaagcaaaagccgaggccgaagcgttagcaaataagaagagc
cgctcccagcgaatagccgagcaccaggccgccgctgcacgacgacgagcagagcaagag
tcggaggaagaaagcgattctgaagaagatctagccgccaagcgtgagaagctacgccga
accgaacaagatgcggacctgaagcatgctgaagacctattcggagacatcgacttgaac
cgcacccgcaaccgcaccgcaccaagcaagagcgtgatatcagatgccaacgacccgacc
aaatccatcgatctagcctcaattcctctcttcaaacccagcacaaaactacaatttacg
gccctgaccaatgccctcgtgccactactaacagcccaggccaagaacccagcatatacc
ctctggctgcaggacttcaccaagcaactagtcaaggatctccccagccaggaaatcaag
aagattgccagtgccatgacggctgccagcaacgagaagctcaaggaagaaaaggcggct
gataagagtggaaagaagaccaaggccgctaagaccaagactagccttgttgctactcgt
ggagcagacctaaacgcttatgatgatgttggtgacgatcttggagatgacgattttatg
tga

DBGET integrated database retrieval system