KEGG   Trichophyton verrucosum: TRV_02849Help
Entry
TRV_02849         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
tve  Trichophyton verrucosum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tve00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    TRV_02849
Exosome [BR:tve04147]
 Exosomal proteins
  Proteins found in most exosomes
   TRV_02849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1853 aa AA seqDB search
MFIRVQRATSPPLPPPPLLLLITHLCYSHLIPSAKLLHYHHIFVFTINFTPSFSFTACLL
KHHVTAPEKARLFIHIDFSTFSFDFLFASQSTACDPQTQTSSLLELSLLLASLCFHPYLS
LLQPALFHSLSLSLLFLPYFFGIAGAPGLLTNVDIVVRNHPLHTSKPSPHSSPQPIDMAP
TACYLDISSDTASFGLMLMGIVVVGIFVCIRQKVNDEDKTQVIIVNLKNNNEVIRRPINA
DSAIMHWNKNIIALKAQGKTIQVFDLQAKQKLKSAVMTEDVVFWKWYSETSIGLITESSV
YHWNVFDPTQHAPLKMFDRIANLASCQIISYRVNEEEKWMVVVGISQQQGRIVGTMQLHS
VERGISQHIEGHAAAFATIKVDGSPLPHKLFTFAVRTATGAKLQIAEIDHQEPNPKFQKK
AVEVYFPQEATNDFPVAMQVSEKYDVVYLITKFGFIHLYDLETGTCIFMNRISSETIFVT
TPNSDSTGIVGVNRKGQVLSVSVDEGTIIPYLLENPANTSLAVKLASKAGLPGADNLLQR
QFEQLLSQGNYAEAAKIAANSPRGFLRTADTINRLKAVSQSGQGMSVILQYFGMLLDKGS
LNVYESVELTRPVLQQNRKHLLEKWLGEDKLKCSEELGDIVRPHDMNIALNIYLKANVPH
KVVAGFAETGQFDKILAYSKQVGYQPDYVQLLQHIVRVNPEKCAEFAGQLANDDSGALVD
LDRVVDVFVSQNMIQQATAFLLDALKDNKPEHAKLQTRLLEMNLVNAPQVADAILGNEMF
THYDKARISQLCENAGLYQRALENTDDSTVIMRNIVRTDKLNPEWLIEFFGRLSVEQSLE
CMNEMLHSNLRQNLQAVVQIATKFSDLLGPTNLIQLLEKYRTAEGLYYYLGSIVNLSEDA
DVHFKYIEAATRMGQMTEVERICRDSNYYNPEKVKNFLKEAKLAEQLPLITVCDRFNFVH
DLVLYLYQNQQYSSIEVYVQRVNPSRTPAVVGGLLDVDCDESIIKNLLTTVDPASIPIDE
LVAEVEKRNRLKILLPFLENTLSTGNQQQAVYNALAKIYIDSNNNPEKFLKENDLYDTLT
VGKYCEKRDPNLAYIAYRKGQNDLELINITNDNSMYRAQARYLLERADSEIWAFVLNGNN
IHRRSLVDQVIATAVPESSEPDKVSVAVKAFLEADLPTELIELLEKIILEPSPFSDNSSL
QNLLMLTAAKADKSKLMDYIHKLTEFNADEIAGMCLSVGLYEEAFEIYKKVENHPAATNV
LVEHIVSIDRAQDYAERVELPEVWSKVAKAQLDGLRISDSIASYIRAGDPSNYNEVIETA
THAGKDEDLIEYLKMARKTLREPAVDTAMAFSFARLDKLSELDDFLRGINVADVEASGDK
AYAEGYHQAAKIFFTSISNWAKLATTLVHLEDYQAAVECARKGNSVKVWKEVNAACVAKK
EFRLAQICGLNLIVHAEELQDLVRQYERNGYFDELIALLEAGLGLERAHMGMFTELGIAL
SKYHPDRVMEHLKLFWTRINIPKMIRACEEANLWPELVFLYCHYDEWDNAALAMMERAAD
SWEHHSFKDIVVKVANLEIYYRALNFYLQEQPLLLTDLLQVLTPRIDVNRVVRMFEKSDN
IPLIKPFLLNVQPQNKRAVNNAINDLLIEEEDHKTLRDSVENHDNYDPVDLAQRLEKHEL
VFFRQIAANIYRKNKRWEKSIALSKQDKLFKDAIETAAISGKPEVVEELLRYFVDIGSRE
CYVGMLYACYELIRPDVVLEMSWRHGLHDFTMPYMINMLSQQVQTIEMLKKDNEERKAKE
ASQQKEEDNTPILGGSRLMLTQGPSGSMGGGAPSMFGQQTNGITPQPTGFRPF
NT seq 5562 nt NT seq  +upstreamnt  +downstreamnt
atgtttattcgagtgcaaagggcgacctcaccaccactaccaccaccaccactactactt
ctcattacccacctttgttattctcacctcattccctctgccaaactccttcactatcat
cacatcttcgtcttcactatcaatttcactccaagcttcagcttcactgcctgcttacta
aaacatcacgtgactgctcctgaaaaggcaaggttgtttattcacatcgacttctcgacc
ttctcctttgacttcctctttgcctctcaatcaaccgcttgcgatcctcagacacaaaca
tcctccctgctagagctctctcttctcctcgcctctctttgcttccacccctacctttct
ctccttcagcctgccctttttcattccctctcactctctctcctttttctcccctacttc
ttcggcatagctggcgctccgggtttgttaacgaacgttgatattgtggtacgcaatcac
cctctccacacgagcaagccttctccccattcctcgccccagccaatcgatatggcccct
acggcctgctatcttgatatttcatcggatactgcatcttttgggctcatgttgatgggc
attgtggttgttggaattttcgtctgcatacgacaaaaggtcaacgatgaagataagaca
caagttatcatagtcaatcttaaaaacaacaatgaagtcatccggcgcccgattaatgcc
gatagtgcaatcatgcactggaacaagaacattatcgcgcttaaggcccagggcaagacc
atccaggtctttgacctccaggcaaagcagaagctcaagtcggcagtcatgactgaagat
gttgtcttctggaagtggtacagtgagacaagcattggcttgatcactgagtcctcggtt
taccactggaacgtctttgacccgactcagcatgctcctcttaagatgttcgaccggatt
gcaaatctcgcgagctgccaaattattagctatcgtgttaatgaggaggaaaagtggatg
gtggttgttggtatcagtcaacagcaaggacggatagtaggaacaatgcagctccattcg
gttgaacgaggcatatctcaacacatcgaaggccatgccgccgcctttgctaccatcaag
gtcgacggatcacccttacctcataaactcttcaccttcgctgtcagaaccgcaaccggt
gccaaacttcagattgcagagatcgatcaccaggagcccaaccctaagttccagaagaag
gctgttgaggtttacttcccacaagaggctaccaatgacttcccagttgccatgcaggtt
tctgagaaatacgatgttgtctatcttatcaccaagttcggcttcatccacctctatgac
ctcgagactggtacatgcatcttcatgaaccgcatttccagcgaaaccatcttcgttacc
acaccaaactcagattctactggtattgtcggtgtcaaccgtaagggtcaggtcctctct
gtcagtgtggacgaaggcaccatcattccatatctccttgaaaacccagcaaacacatct
ctggctgtcaagcttgcatccaaggctggccttccgggtgcagataatcttcttcagaga
cagtttgaacagctcctatctcaaggaaactatgcagaggctgccaaaatcgccgccaat
tcgccccgtgggttcctgcgaactgcagacactatcaaccgcctaaaggctgtatcacag
tcaggtcagggcatgtctgtcatcctccaatatttcggaatgcttcttgacaagggatct
ctaaacgtatacgagagtgttgaattgactagacctgtcttgcagcaaaaccgaaaacat
ctccttgagaagtggctcggcgaggataagctgaaatgctccgaggagctaggtgacatc
gttcggccacacgacatgaacattgctttgaacatctacctcaaggccaatgttccccac
aaggtcgttgctggcttcgcagagactggtcaattcgacaagatcctggcttactccaag
caagtcggctatcaacctgactatgtccagcttctacagcatattgtccgagttaaccca
gagaagtgtgcagagtttgctggtcagcttgccaacgatgacagcggtgccctcgttgat
cttgaccgtgttgtcgatgttttcgtctctcagaacatgatccagcaagctactgcattc
ttgttggatgctctcaaggacaacaagcctgagcatgctaagcttcagactaggctgcta
gagatgaaccttgtcaacgctcctcaggtcgccgatgctatcctgggtaacgagatgttc
acccactacgacaaggctaggatctcacaactctgcgagaacgcaggtctctatcagcgt
gcgctcgagaacactgatgattccacagtcatcatgcgcaacattgtccgcacggacaaa
ctgaaccccgaatggttgatagaattctttggccgcctttcagtggaacagtccctggaa
tgtatgaacgagatgcttcactcaaacctccgtcaaaatcttcaagctgttgttcaaatc
gctaccaaattctctgaccttttggggcctaccaacctcatccaattgcttgagaaatac
cgaactgccgagggtctctactactaccttggcagcatcgtcaaccttagtgaggatgcc
gatgttcactttaagtatatagaggccgctactcgcatgggccagatgaccgaagtcgag
cgtatttgccgcgacagcaactactacaatcctgagaaggtcaagaatttcctcaaggag
gccaagcttgctgaacaacttcctttgattactgtttgcgatcgattcaactttgtccac
gatctagttctgtacctctaccagaaccagcagtattcttcgatcgaggtttacgttcaa
agggtcaacccatcaaggactcccgctgttgtcggtggcctgcttgacgtggactgtgat
gagtctattatcaagaaccttctcactactgttgacccagcttctatcccaattgatgag
cttgtcgccgaggtagagaagagaaacagactcaagattcttttgccattcctagagaac
actctcagcaccggtaaccaacagcaagcagtctacaatgccttggccaagatatacatt
gacagcaataacaaccccgagaagttcctcaaggagaacgacctctatgatactctaact
gtcggaaagtactgtgagaagcgagaccctaatcttgcatatattgcataccgcaagggc
cagaatgatcttgagcttatcaacatcaccaacgacaactcgatgtatcgtgctcaagct
aggtatctgcttgagcgagctgatagtgaaatttgggcctttgttttgaacggaaacaac
attcacagacggtcccttgttgaccaggttattgccactgccgtcccagagtcttctgaa
ccagacaaggtgtcggtagcagtcaaggccttccttgaagcagacctgccgacggagctc
atcgagttactggagaagatcatcctggagccatctcccttcagtgataacagcagcttg
cagaacttgctgatgctcaccgctgccaaggccgataagagcaagctgatggactacatc
cacaagcttacagaattcaatgctgatgagattgcgggaatgtgtctgtctgttggcctg
tacgaagaagccttcgaaatttacaagaaggttgagaaccatcctgctgccaccaatgtt
cttgtggaacacattgtcagcatcgaccgtgctcaggactatgctgagcgtgttgaactt
cccgaagtatggagcaaggtcgccaaagctcaattggatggccttcgcatctccgattct
atcgcttcatacattcgtgccggagacccttcgaactacaatgaagttatcgaaaccgct
acccatgctggcaaggatgaggacctcattgaatatcttaagatggcccgcaagactctt
cgagagcctgctgtcgatactgccatggccttcagttttgctagactcgacaagctctcc
gagcttgacgatttcctccgtggaatcaatgttgccgatgttgaagcttccggtgacaag
gcctatgccgagggataccaccaagctgcaaagatattcttcaccagcatctccaactgg
gcaaaacttgcaaccacacttgtccatctcgaggactaccaagctgctgttgagtgtgct
cgcaagggtaacagcgtcaaggtctggaaggaggttaacgcagcctgcgttgccaagaaa
gaattccgccttgctcagatttgcggcttgaacttgatcgtgcatgctgaggagctacaa
gacctggtccgccagtatgagcgtaatggctacttcgacgagctcattgctctgcttgag
gccggtcttggtcttgagagagcccacatgggtatgttcactgagctaggaattgccctg
tcgaagtaccatccagaccgtgtgatggagcatctcaagttgttctggactcgaatcaac
atccccaagatgattcgcgcgtgcgaggaagccaacctatggcccgagctggttttcctt
tactgccactacgacgaatgggataacgcggcgctagcaatgatggagcgagcagccgat
tcgtgggaacatcactctttcaaggatattgttgttaaggttgccaacctggagatctac
taccgtgccctgaacttttatctgcaagaacaacccctgctgctgacggacctactccaa
gtccttactccccgcatcgacgtcaaccgggttgttcgcatgtttgagaagtcggacaac
atccccttgatcaagcccttccttctcaatgtacagccgcagaacaagcgtgcggtcaat
aatgccattaacgacctgttaattgaagaagaagaccacaagactctgcgagactcggtt
gagaaccatgacaactacgatcccgtcgacctggcgcagaggctggagaaacacgagctt
gtattcttccgccagattgcagccaacatctaccgcaagaacaagcgatgggagaagtcc
atcgccctctcgaagcaggacaagctgttcaaagatgctatcgagaccgctgcgatctct
ggcaagcccgaggttgtcgaggagctgttgcgctacttcgtcgacattggcagccgtgaa
tgctacgtgggcatgctatacgcctgctacgagctcatccgccctgatgtggtattggag
atgtcgtggcgccatggcctccacgatttcacgatgccttacatgatcaacatgctgagc
cagcaagtgcagaccattgagatgttgaagaaggacaatgaggagcgcaaggcgaaggaa
gcctctcagcagaaggaagaggacaacacgcccatcctcggaggctcgagactgatgctg
acgcaaggtcccagcgggtcaatgggagggggtgcgccgtcgatgtttggacagcagacc
aacggcataaccccccagccaaccggcttccggccattttaa

DBGET integrated database retrieval system