KEGG   Trichophyton verrucosum: TRV_02973Help
Entry
TRV_02973         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tve  Trichophyton verrucosum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tve01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tve01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tve00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tve00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tve00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 300 aa AA seqDB search
MAGPATTGVTYPALPKTLLIVSLKMYFTPSRTLEYLRELLEPRNEIVCARNRSKLLLALI
PDFLTVYPCSEVVKEFTTKQPGAQQSTAESVPGPLSQPPSFLLGAQDCFWEAAGPYTGEV
SPASLRSMNVSIVELGHAERRAIFKETDEQVGRKAAAVSAQGMVPLVCVGEIPVPGPVMS
EAVGVAVKECEVQVRAVLDAIPQDAPCIFAYEPVWAIGQPVPAGVDHISAVVQGIRSVID
RVRSGSSRGEIRVIYGGSAGPGLWAQGGLGKAVDGMFLGRFAHEIEGVRKVVREVEESLE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggccggtccagcaacaacgggggtgacatacccagctctcccgaagacactcctaata
gtctcgttaaagatgtatttcaccccttcgcggacgctggaatacctacgagaattgctt
gagccacggaacgagatcgtctgcgccagaaacagatcaaaactcctactcgccctcatc
ccggacttcctgaccgtctatccatgctctgaggtggtcaaggagttcaccaccaagcag
cccggtgcgcagcagtcgacggcggaatctgtcccgggacccttgtcgcaaccaccttcc
ttcctgctcggagcccaggattgcttctgggaggctgcgggcccgtatacaggggaagtg
tcgcccgccagtctacgctcgatgaacgtgtcgatagtcgaattgggccatgcagagcgc
cgggcaatcttcaaggaaacagacgaacaggtcgggcggaaagctgcagccgtcagcgca
caggggatggtcccacttgtgtgtgtgggcgaaatacccgtccctgggcctgtgatgtca
gaggctgttggagtggcggtaaaagagtgtgaagttcaggtcagagcagtgcttgatgcg
attccgcaggatgcgccgtgtatctttgcctacgagccagtatgggcaattggacagcca
gttcctgctggcgtcgaccatatatctgccgtggttcaggggatacggagcgtcatcgac
agggtgcgcagcggctcgagcagaggggagatcagagtgatatatggaggcagtgcaggg
ccggggctttgggcgcaaggcgggctagggaaggctgtcgatggcatgttcctgggccgg
tttgcgcatgaaatcgagggagtacggaaggtagtccgagaggtcgaggagagccttgaa
taa

DBGET integrated database retrieval system