KEGG   Trichophyton verrucosum: TRV_03028Help
Entry
TRV_03028         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tve  Trichophyton verrucosum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TRV_03028
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TRV_03028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 166 aa AA seqDB search
MRCVFSGYADTTRGPRPGEEDGREYNFTTKEAFLKLVDEGGFIEHAQFGGNHYGTSIAAV
KRVADQGRICVLDIEMEGVKQVKRTDLNARFLFLAPPSIEELERRLRGRGTESEDSLQKR
LAQARVELEYSRQPNAHDKIVVNDELEAAYAELRDWVVDGGKFGSP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgtgtgttctcggggtatgcagacaccactcgaggccccagaccaggcgaggaa
gatggcagggaatacaacttcaccaccaaggaagctttcctgaagctcgttgacgaggga
ggattcattgagcatgctcagttcggcggaaaccattacggaaccagcattgcggccgtg
aaacgtgttgcggaccaaggaagaatatgcgtccttgacattgagatggagggtgtgaaa
caagtgaaacggaccgatctcaatgccaggttcctcttccttgctcctccgtctatcgaa
gagttggaaagacgcctgcgtggtcgcggtactgagtcagaggacagtctgcaaaagcga
ctggcccaggcccgagttgagttagaatactcgaggcagcctaatgcacatgacaagatt
gttgttaacgatgagcttgaggcggcatatgccgagcttagagattgggtggtagatggc
gggaagtttggctcgccatga

DBGET integrated database retrieval system