KEGG   Trichophyton verrucosum: TRV_03049Help
Entry
TRV_03049         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
tve  Trichophyton verrucosum
Brite
Enzymes [BR:tve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TRV_03049
Peptidases [BR:tve01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TRV_03049
Exosome [BR:tve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TRV_03049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 697 aa AA seqDB search
MSKLAIEASSEDDQYDVATKIVCLECGVDKVEDCPPKAAEVVDKLMKAPTFSRKEEVKAW
EQELVPCEHTIGLQQGSNQGIRIREPSKCYGCDLQENLWLCLECGTVGCGRAQFGGIGGN
SHALAHSNEKSHGVAVKLRSITPEGSADIYCYTCNDERTDPELAQHLSHWGINIAEQEKT
EKSLTELQIEQNLKWDFSMTSNDGQVLNPVFGPELTGLKNLGNSCYIASVLQCLFSLPEF
KARYFKPNEEPPSSSAPAEDLETQLRKIADGLLSGRYSVPDPAAAGSTSDVVYQRGLLPS
MFKHMIGRGHPEFSTMRQQDAFELLLHLFKIISVSTHSASDPNPVESFRFAVEQRLQCTS
CKKVRYKVDEQDNISVEVPAIRLNHFMPGPGTDQKWETVPLENCIDLFTREEHVELTCSG
CGNKQFSKQTLFKTLPQNLIVNARRWEVVNYVPMKLDIPVVVGNEPLDLTQYLSKGKQED
EEVLEDEPESAAPEFVPNSDAFAALCGMGFPENRVKRGLFSTGNSDQEAALNWILAHMDD
PDIDQPLVTGAGSASGAQKPADGDDKINQLADMGIERDRAEKALGATDWDVTRALDWVFS
HPDEPLEPNPTAATNSSGPSGSIPGSSEKPALFDLQSIVCHKGTSVHAGHYVAFIRKQVP
PEKEPRWILFNDEKVVAEAGDIKEMKQFAYIYIFRRV
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagctagctattgaagctagctctgaggacgatcaatacgacgtggccacaaaa
atagtctgccttgaatgtggtgtggacaaagtggaagactgcccacctaaagcagctgaa
gttgtcgacaaactgatgaaggcacccactttctcccggaaggaagaggtgaaggcttgg
gaacaagagcttgttccatgcgagcataccataggtctacagcagggctccaatcagggt
atccgaatcagagaaccatccaagtgctacggatgtgacctgcaggagaacctttggctc
tgcctggaatgcggtaccgttggctgcggacgagcacagtttggcggcataggaggtaac
tcgcacgctcttgctcattcaaatgaaaaatcgcatggcgtggcggtcaaacttcgatcc
attacccctgagggttctgcggatatctactgctatacatgtaatgatgagaggacagac
ccggaactggcacagcacctatcccactggggaatcaatattgcggagcaggagaaaacc
gagaaaagcttaaccgagctccaaattgagcaaaacctgaaatgggacttctcaatgact
tctaatgatggacaagtattaaacccagtctttggacctgagcttactggactcaaaaac
ctcggaaacagctgttacattgccagcgtcttacaatgcctattctcattgccggaattc
aaggctcgctacttcaagcccaatgaagagcctccatcttcctctgctccagctgaggac
cttgagactcaactaaggaaaatagctgatggtctcctttctgggcgttattctgtgcca
gacccagcggcagctggtagtacctcggatgttgtttaccagcgtggactcttgccatcc
atgttcaaacacatgattggccgaggccatcccgaattctcaaccatgcgccagcaggat
gcattcgaactacttctgcaccttttcaagattatcagcgtatccacacactctgcttct
gatccgaatccggtagaatcattcagattcgctgttgagcaacgattgcaatgtacatca
tgcaaaaaggtgcggtacaaggtcgatgagcaggacaatatctcagttgaggttccggca
atccgactcaatcattttatgccagggcctggaacggatcagaagtgggaaacagtacct
cttgaaaattgtattgatctgttcacaagggaagaacatgtcgaattgacttgttcgggc
tgcggaaacaaacaattctccaaacagacgctgttcaaaacactcccacagaatctcatt
gttaatgcacgacgatgggaggtagtgaactacgtgcctatgaagcttgacatacccgtg
gtggttggtaatgagccactggatctgacccagtatctctcaaagggcaaacaggaagat
gaagaggtcctggaggacgaacctgaaagcgctgcccctgaatttgtgccgaactcggat
gcctttgctgccctatgcggcatgggcttccccgagaatagggtgaagaggggactgttc
agtactggtaactcggaccaggaggcagctttgaactggatcctcgctcatatggatgat
ccagacatcgaccagcccctggtaactggcgcgggctctgcttctggcgcccagaaacct
gccgacggagatgataagatcaaccagctggctgacatgggtattgagagagatagggct
gagaaggcacttggggccacagactgggatgtgacgagagctttggactgggtctttagt
catcccgatgaacctcttgagccgaatcctacagcagccacaaacagctcgggcccatca
ggcagcatcccgggatccagcgagaagccagccttgttcgacctgcaatccatcgtctgc
cacaaaggcacctcagttcatgcaggtcactacgttgcttttatccgcaagcaggtcccg
ccagagaaggagccgaggtggattcttttcaacgatgagaaagtcgtggccgaagctggt
gacatcaaagagatgaaacagtttgcgtacatatacatattccgtcgtgtgtaa

DBGET integrated database retrieval system