KEGG   Trichophyton verrucosum: TRV_03411Help
Entry
TRV_03411         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
tve  Trichophyton verrucosum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TRV_03411
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TRV_03411
Enzymes [BR:tve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TRV_03411
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     TRV_03411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2248 aa AA seqDB search
MPAIPSSPELKGPSREPPFPSSPSTGGVVAYNNELHGLRTTTSGAIFSPASMQLGSKKGR
PVGLELEDGTVYRGFNFGAERSIAGELVFQTGMVGYPESLTDPSYRGQILVITFPLVGNY
GVPSRDKMDELLKGLPKHFESNQIHVAGLVVASYCGEAFSHFLAESSLGEWLKEQNVPAI
YGVDTRALTKRIREKGSMLGRMLLRKETSVSHDSAVEQQPENWRENYEVLDWEDPNKRNL
VDDDVGLKYNQLRCLLSRGVEVLVVPWNYDFPNLAGKEYDGLFLSNGPGDPATLASTVSH
LKIALKENKTPIFGICLGHQLLARAAGASTLKMKFGNRGHNIPCTSMLSGRCYITSQNHG
YAVDSKTLPEGWEELFVNANDASNEGIRHASRPLFSVQFHPESTPGPRDTEFLFDVFINT
VKECLESKDALSKPVNFPGGTIKENTAAHPRVHVKKVLILGSGGLSIGQAGEFDYSGSQA
IKALNEEGIYTVLINPNIATIQTSKGLADKVYFLPVNAEFVRKVIKRERPDAIYVTFGGQ
TALQVGIQLKDEFEELGVKVLGTPIDTIITTEDRELFARSMEVIGEKCAKSASASNLEEA
MEAVRGIGFPVIVRAAYALGGLGSGFAENDDQLRDLCTKAFAASPQVLIERSMKGWKEIE
YEVVRDARDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGV
VGECNIQYALNPFSREYCIIEVNARLSRSSALASKATGYPLAFIAAKLGLGIPLNEISNS
VTKVTCACFEPSLDYVVVKIPRWDLKKFTRVSTQLGSSMKSVGEVMSIGRTFEEAIQKAI
RAIDFHNLGFNETSALMSIKNELQTPSDQRLFAIANAMHSGYTVDEIWELTKIDKWFLRK
LEGLSLFGKQMSSYNATTVPIPLIRQAKQLGFSDRQLARFLSSNELAVRRMRVEAGIIPF
VKQIDTVAAEFPAFTNYLYLTYNGSENDVAFDDQGIMVLGSGVYRIGSSVEFDWCSVRTI
RTLRAQGHKTVMVNYNPETVSTDYDEADRLYFENITLETVLDIYQLESSSGVAISMGGQT
PNNIALPLHRLNVKILGTSPEMIDTAENRYKFSRMLDRIGVDQPAWKELTSIEEATAFCD
KVGYPVLVRPSYVLSGAAMNTVYSQDDLANYLDQAAEVSREHPVVITKYIENAKEIEMDA
VAKNGVMCGHFISEHVENAGVHSGDATFIVPPQDLDPETVRRIEEATSKIGNALNVTGPF
NIQFIAKDNEIKVIECNVRASRSFPFVSKVMGVDLIEMATKAMIGKPFEAYPPVNIPQRY
VGIKVPQFSFSRLSGADPVLGVEMASTGEVACFGRDRYEAYLKALISTGFKLPEKNILVS
MGSFKDKMEMLPSITKLHKMGFNLFATAGTADFLREHGIPVKYLELLAGDGEDLKSEYSL
TQHLANNLIDLYINLPSSNKFRRPANYMSKGYRTRRMAVDYQTPLVTNVKNAKILIEAMS
RRYDLSVAPIDFQTSHRTVSLPGLINVAAFVPGIAEKDSADFQEVTKASIAAGFSMIRVL
PVGINSFVTDAQALKLAQLNSQKGSYCDFNFSVTATATNADQVDLISSEVGSLFIPFNHL
AGNINKVATVTTHFASWPSNKPIITDAKGTDLASILLLASLHNRNVHVMSVTSQEDIKLI
ALSKEKGLRVTCDVSIYSLFLSQETFPESCHLPTKKAQESLWEHLGTIDVFSVGSLPYET
AGKEASPTVGLADALPILLTAVSEGRLTIDDITKRLYENPKRIFELHDQQDTFVEVEVDR
PYVFKSQGAWSPFTGKTLRGSIQRVNFQGKTACLDNELLSDAPKGMDMSSHTPAPPQSPS
MKEMAPRSPMAMGSIGRRLSFTTTPQARPSPLKKADSLATADELGPPLYATPSTGGTPSL
QELLSRSTFRHKHILSVNQFNRSDLHLLFTVAQEMRLGVQRQGVLDILKGRVLCTLFYEP
STRTSASFDTAMQRLGGRTVAIATQHSSAQKGETLQDTIRTLACYSDAVVLRHPEESSAS
TAAKFSPVPIINGGNGSQEHPTQAFLDLFTIREELGTVSGITVTFTGDLKHGRTVHSLIK
LLQFYQVRIQLVSPKALSLPEDIRQQVIGSGQLIVETNELTPEVVARSDVLYCTRVQKER
FADQEEYERLKNSFVIDNSIMNQAKSQMVVMHPLPRNAEIDEQVDFDQRAAYFRQFYFAS
LQTGVFGTLYQFLCHICVTKVLFDFMSV
NT seq 6747 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccattccctcttctcccgagctcaagggcccttcgcgagaaccaccgttccct
tcaagcccttcaaccggtggtgttgtcgcatacaacaacgaactccatggtctccggacc
accacaagtggagccatattttctccagcttcaatgcaattgggctcgaagaaaggaaga
cctgtcggtcttgagctcgaggatggcactgtctacagaggattcaactttggagctgag
aggagcattgccggagagttggttttccaaactggcatggtggggtatcctgaatccttg
acagatccctcgtatcgtggtcagatcctggtcataacgtttcctctcgttgggaattat
ggtgtgccgtcgcgtgacaagatggatgagctgttaaagggcctgccaaagcactttgag
tcgaaccagattcatgttgccggcttggtggtagctagctactgtggtgaagctttctct
cacttcctagccgaaagctctctcggtgaatggttgaaagagcaaaatgtgcccgccatt
tatggtgttgatacccgagctttgactaaacgcatcagggaaaagggtagcatgctggga
cgcatgcttctccgaaaggaaacttctgtttcccatgatagcgctgttgagcagcagcca
gaaaattggagagaaaactatgaggtgcttgactgggaagacccaaataaaagaaatcta
gttgatgatgatgtcggtttgaaatacaaccaactgaggtgcctgctctctcgtggtgtc
gaggttctcgtcgtaccatggaactacgatttcccaaaccttgcaggcaaagaatatgat
ggacttttcctctcaaacggccctggcgatcctgccaccctagcttccacggtttcccac
ttgaagatcgctctcaaggagaacaagacaccaattttcggcatctgccttggacaccaa
cttctagcaagagcagcaggtgctagtactctcaagatgaaatttggaaaccgtggacac
aacattccatgcacaagcatgctctctggtcgctgttatattacatcccagaatcatggt
tatgctgttgattccaaaactcttccggaaggctgggaggagctgtttgtcaacgctaac
gatgctagcaacgaaggaatcagacatgctagccgtccactattcagtgtgcagttccat
ccagagagtacacccggaccacgggatacagagttcctatttgatgttttcatcaacact
gtaaaggagtgtcttgagtccaaagatgctttatctaaacctgtcaatttcccaggtgga
actatcaaagagaatactgctgcacatccccgagtccacgtcaagaaggtcttgatcctc
ggcagtggtggccttagtattggccaggctggagagtttgattactctggtagccaagct
atcaaagcgttaaatgaagagggaatatacaccgttcttatcaatcctaatatcgctacc
attcagacttcgaagggactggcagataaggtgtatttccttcctgttaatgctgaattc
gttcgtaaggtgataaaacgcgagcgacctgatgctatctatgtcacatttggtggtcaa
acagcccttcaagtcggcattcagctcaaagatgaatttgaagagctgggtgtgaaggtg
cttggtacaccaatcgacactattattacaaccgaggaccgtgaactctttgctcgtagc
atggaggtcattggcgaaaagtgtgccaaatctgcgtcagcttccaatttggaagaagca
atggaagccgtgaggggtattggattcccagtaattgtcagagctgcctatgctctaggc
ggattgggaagtggttttgctgaaaatgacgatcaacttcgagacctttgtaccaaagca
tttgctgcaagtcctcaggttcttattgagaggagtatgaagggctggaaggaaattgag
tacgaggtagttcgagacgcccgcgacaactgcatcaccgtctgtaacatggaaaacttt
gatcctttaggaatccataccggtgactctatcgtcgttgcaccatcccagacactatct
gatgaagattacaatatgcttcgcaccacagctgtcaacgttatccgccatcttggagtt
gtcggcgaatgtaatattcaatacgctctcaaccctttctcgagagaatattgcattatt
gaagttaatgctcgtttatcgcgatcctcagcattggcttcaaaggctactggatacccc
cttgcatttatagctgcaaaacttggtctcggaattccactaaacgagatatctaactct
gtgaccaaggttacttgtgcctgtttcgagccttccctagactatgtcgtcgttaagatt
cctcgatgggacttgaagaaattcacccgtgtatcaactcaacttggctcatcgatgaag
agtgtaggagaagtcatgagtattggaaggacgttcgaggaagccatccaaaaagccatc
cgagctatcgatttccacaatcttgggtttaacgaaacaagtgctttgatgagtatcaag
aacgagctccaaaccccatccgaccagcgactttttgctattgccaatgctatgcactcc
ggctacactgttgatgaaatatgggaattgaccaaaatcgataaatggttcttgcgaaaa
ctcgaaggactgagcctatttggcaagcaaatgagtagctataacgctactactgtccct
attcccctcatcaggcaagccaagcaactcggattctctgaccgccagcttgcgaggttc
ctaagctccaatgagcttgctgttcggcgtatgcgtgttgaggcaggtataattcccttc
gttaaacaaatcgatacggtggcagctgaattccctgcttttacaaactacctataccta
acctacaacggatccgaaaatgatgtggcgtttgacgaccaaggtatcatggttcttggc
tcaggcgtttatagaattggatcttccgttgaatttgactggtgctctgttagaacaatt
cgcacacttcgagcacaagggcacaaaactgtcatggttaattataacccagagacagtc
agtactgattacgacgaggcagatcgtctctattttgaaaatatcaccttggagacagtt
cttgatatctaccagctggagtcatctagtggagtggcaatttctatgggcggacagacg
ccaaacaacattgccctgccactccatcgcctcaatgttaaaatccttggaacgtctcct
gagatgattgatacagctgagaaccgttacaaattctctcgtatgcttgacagaattgga
gtcgatcaaccggcatggaaagaacttactagcattgaagaagctactgcattctgtgac
aaggttggctaccctgttcttgtccgcccttcatatgtcctctcaggagcagctatgaac
actgtctactcccaagacgatttggcgaactatcttgaccaagcggccgaggtgtcgcga
gaacaccccgttgttatcacaaaatatatcgaaaatgctaaggaaatcgaaatggatgct
gtggctaagaatggtgttatgtgtggtcattttatctctgagcatgttgaaaatgctggt
gtccattctggtgatgctacttttattgtcccgcctcaggacttggacccggagacggtc
agaagaatcgaagaagcaaccagcaaaattggaaatgctctgaatgttactggacctttc
aatattcagtttattgccaaggacaatgaaatcaaagtcattgaatgcaacgtccgggct
tcgcgatctttcccatttgtctcaaaggtcatgggcgttgatttgattgagatggcgact
aaggctatgatcggaaaaccatttgaggcatacccaccagtaaatataccccaacgttat
gttggcattaaggtgccacaattttcattctctcgactctctggtgcagaccctgtactt
ggcgtagagatggcttctacaggtgaggttgcctgtttcggtcgcgatcgatacgaggca
tatctgaaagcgctcatatcgacgggatttaagttgcctgagaagaacatccttgtctcg
atgggctccttcaaggataagatggagatgcttccatctatcaccaagcttcacaagatg
ggcttcaacctttttgccactgctggtacagctgacttcttgcgggaacatggcattcca
gtgaaatacttggaacttttggcaggagatggcgaagacttgaagtctgaatactctctt
acacagcatctagcgaacaacctcatcgacctttacatcaaccttccttccagcaacaaa
ttcagacgaccagcaaattatatgagcaaaggttaccgcacccgacgaatggctgttgac
taccaaactccccttgtgacaaatgtcaagaacgccaaaattttaatcgaagccatgtct
cgacgctatgatttgagtgtggcgccaattgatttccaaaccagccaccggactgtatcg
ttgcctggactcatcaacgttgctgcatttgttccaggtattgctgagaaggattcagct
gacttccaggaagttactaaggcatccatcgctgctggtttctccatgatccgagtcttg
cctgtaggtatcaacagctttgtcacggatgcacaagccctaaaattggcacagctcaat
tcacaaaagggttcttactgtgattttaacttctcagttaccgcgactgccacgaatgcc
gaccaggttgaccttatatccagtgaggttggctcattgttcatcccattcaatcacttg
gccggtaatatcaacaaggttgctacagtcacgactcattttgcatcttggccatccaac
aagcctatcataactgatgcaaagggtacagaccttgcctcaatacttcttctggctagc
cttcataaccgcaacgtacatgtcatgagtgttacatctcaagaagacatcaaactcatc
gcgcttagcaaagaaaaggggctaagagtgacctgcgatgtttctatatactcgttgttt
ttgtcacaggagaccttcccagagagctgtcacctgccaaccaagaaagcccaagaatcg
ctctgggaacatctcgggacgattgacgtgttcagtgttggaagtctcccatacgagacc
gctggaaaagaggcatctcccacggttgggttggcagatgcactcccaatcctcttgacc
gcagtatctgaagggcgactgaccatcgacgacattaccaaaaggctgtatgagaatccg
aagaggattttcgagctccatgaccagcaggatactttcgtggaagttgaagttgatcgc
ccctatgttttcaagagccagggtgcttggtcaccatttactggtaaaacactacgtggc
tccatccagcgtgtcaatttccagggaaagacggcgtgccttgacaatgaactactttct
gacgcacctaagggcatggacatgtcgtcccacacaccagcaccaccccagtcaccttcc
atgaaagagatggcccctcggtctccaatggcaatgggctcgattggcaggcgcttatca
ttcacgactactccacaagcgcgcccatcaccactgaaaaaagctgattcccttgctaca
gctgatgagcttggaccaccactatacgctactccatccactggaggaaccccctcgctc
caggagctactttctcgctccacgtttaggcataagcatatactgtctgtcaatcagttc
aacaggtcagaccttcatttattgtttacagtagcgcaggaaatgcgactcggggtccag
cgtcaaggagttctcgatattctcaagggtcgtgttctatgtactctgttctacgaacct
tctacccgtacttctgcctcgtttgacacagcaatgcaacgactgggtggtcggactgtg
gctatcgccacccaacattcatctgctcaaaagggagaaaccctgcaggatactattcgc
actcttgcttgctattccgatgcagttgttctacgccatcctgaggagagcagcgcgtct
acggcagccaaattctcccctgttccaataatcaatggaggaaatggaagccaggagcac
cctacccaggcgttcctcgatctctttaccattcgtgaagaattaggtaccgtgagtgga
atcactgttacgttcacaggtgacctgaaacatggaagaacagtccactccctcattaaa
ttgcttcagttctatcaagtccgcattcaacttgtttctcctaaggctctgtctttgccg
gaagacatccgccagcaagttatcgggtctggtcagctcattgttgaaaccaacgagttg
acccctgaagttgtggcccgctccgacgtcttatactgtacccgagtccaaaaagaacga
tttgcggaccaagaggaatatgagaggctgaagaacagcttcgtcattgacaattctatc
atgaaccaggcgaagagccagatggtggtcatgcatccgctcccaagaaacgctgaaatt
gatgagcaagtggactttgaccagcgcgctgcttactttagacagttttactttgcctcg
ttacagacgggtgtctttggcactctttaccagtttctttgtcatatatgcgtcacaaaa
gttttgtttgatttcatgtcggtttaa

DBGET integrated database retrieval system