KEGG   Trichophyton verrucosum: TRV_03489Help
Entry
TRV_03489         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K01887  
arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
tve  Trichophyton verrucosum
Pathway
Aminoacyl-tRNA biosynthesis
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:tve00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 705 aa AA seqDB search
MHQQLLRSSLTVYSGIFKPRISISSFSSYCRLLPRNLGRSRTPPPYIDRRGTTLSLTTAT
RPVLTMASDAIPSIASLSIQSVSSEVSSYPNCYPAFNPVDKYRAHIAELVAEASGLEPAF
VYTKILWTNMLDKGDLILPIKGKKPQEIAADIAAKFPKSDLIEPPVVVGAHLQFFYSHRP
MTENVIRSILANKDAYGSNPNVGLRDQRDASKGKKKLVVEFSSPNIAKPFHAGHLRSTII
GGFIANLYTILGWEVLKINYLGDWGKQYGLLASGYEKYGSEEELLKDPINHLFEVYVKIN
QDVAAQEGPIKELKEQIKAKKEKNEDVTELEKKLEPLVDASYDEQARRYFKSMEDGDEKA
LELWRRFRDLSIDKYKQTYARLNIDFDVYSGESQVKDESIKKSYKAMENAGVSESSEGAV
IIDFAKHGAKKLGKAIVIRKDGTPLYLTRDIAAIVERDDEYQFDKMIYVVAAQQELHLAQ
LFKTTELVGKKDLANRCEHISFGMVRGMSTRKGTVKFLNDILKDVGEKMHEVMQKNQAKY
EQIEDPVATADVLGITSVMVQDMSGKRINGYEFNLENMTSFEGDTGPYLQYAHARVCSVT
RKAEINPEELGSADLSLLTESHAVDLVRLLAQWPDVVFNASKTLEPCTILTYLFRMTHML
SSGYDVLKVVGSEPEVKMARMALYESARQVLHNGMRLLGLNPVKR
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagcaactccttcgaagctctttaactgtatactccggcatattcaagcctcga
atcagcatatcaagtttctccagctactgtcggctgctgccacgcaacctgggtcgaagt
cgaaccccaccaccatacatcgacaggcgcgggacgactctatcattgactacggctact
cgtccggtattaaccatggcttcagacgctattccttctattgcgagtctgtcgattcag
tccgttagctcggaggtgtcgagttatcccaattgctaccctgctttcaacccagtggac
aagtaccgcgcgcatattgcagagttggtcgcagaagcttcagggctggaaccggcgttt
gtctataccaagatactatggacaaatatgctggacaagggtgacttgattctccctata
aagggcaaaaagccacaagaaattgcggcggatatcgctgccaaatttccgaaatctgac
ctgattgaaccaccagtcgtcgttggtgcgcatcttcagttcttttacagccatagacct
atgaccgaaaacgtgatccgctcgattttggcaaacaaagacgcatatggaagcaatcca
aacgtcggtctacgagatcaaagagatgcaagcaaaggaaagaagaaactcgtggtagag
ttctcgtccccaaatattgcgaagcctttccacgccggacatcttcgaagtaccatcatt
ggtggatttattgccaacctatacacaattctaggatgggaagttctcaaaatcaactac
cttggagactggggaaagcagtatggcctgcttgccagcggatacgaaaagtatggcagc
gaagaggagcttctgaaggaccccatcaaccacctatttgaggtctatgtgaagatcaac
caagacgtagctgcacaggaaggcccgataaaggagctcaaggagcagatcaaagccaaa
aaggagaagaatgaagatgtcacggagttggagaagaagctcgagccactagtcgatgca
agctatgatgagcaggcccgtcgatacttcaagagcatggaagacggagatgagaaagca
cttgaactgtggcggcgattccgagatctcagtattgacaagtacaagcagacatatgct
cggctgaacatcgattttgatgtttactctggagagtcccaagtcaaggacgaaagcata
aagaaatcctacaaggccatggagaacgcgggtgtctcggaaagctcagaaggcgctgtc
atcatcgattttgcaaaacacggggcaaagaagcttggaaaggccatcgtgatccgaaag
gatggaacgccgctctatctcacacgagacattgctgctatcgttgagcgagacgacgaa
taccagttcgataagatgatctacgttgtagctgctcagcaggagcttcaccttgcccag
ctgttcaagacaacagagttagttggaaagaaggatctggcaaaccgttgtgagcatatc
agcttcggtatggttaggggaatgagcactcgaaaaggaacagtcaagttcctaaacgat
attctaaaggatgttggagaaaaaatgcacgaggtcatgcaaaagaaccaagccaagtac
gagcagatcgaagatccagtggcaaccgccgatgttcttggaataacgtcagtgatggtg
caggatatgagcggtaaacggatcaacgggtatgagttcaacctagagaacatgacctcg
ttcgagggtgacacagggccatacctgcaatacgcacacgcgcgtgtctgctctgtgacc
agaaaggccgagatcaacccggaagaactaggcagtgcagacctcagtttacttacagag
tcgcatgccgtcgacctagtccgcctactcgcccagtggccggacgtggtattcaatgcc
tccaagacgctggagccttgtacaatactgacatatttgttccgaatgacacacatgctg
agttccggctatgatgtcttgaaggtcgtgggcagcgagccggaggtgaagatggcgaga
atggcgctttatgagtccgcccgtcaagtcctccataatggcatgcggcttctgggtttg
aaccctgtcaagcggtga

DBGET integrated database retrieval system