KEGG   Trichophyton verrucosum: TRV_03640Help
Entry
TRV_03640         CDS       T01615                                 

Definition
endosome-associated ubiquitin isopeptidase (AmsH), putative
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
tve  Trichophyton verrucosum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tve00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    TRV_03640
Enzymes [BR:tve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TRV_03640
Peptidases [BR:tve01002]
 Metallo Peptidases
  Family M67
   TRV_03640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 585 aa AA seqDB search
MLPPLTVEQIARQAGQYEFDPQVPLRYWLRSAGLLVKEARIYEQEGNDQQAYLLLFRHAQ
LVLINLTAHPDARDPKNKQGLAAAKKEVQASLNKLEILKPRIRRLHDRYQELQQRSQAEN
HAAATTTASTMEDHTATTFSDLDATIQSATTVQDPALAGRPEALQAAENRDFAVRLAQSE
FRRRAFARGDARRPSYASSEASVSTANTANTTNTAKMEGDVLARRLQEVRSMLSSGLSKS
NTTSSSSPTSRSPTLMPIEQHLSGYRYPSIPRQSCQHHHTGSHSPIRPPKIEQAPPVPGK
TPTIPAKIPDPDITSSSTAASTTSLLPPLPSKVPPLPPRAGSVTPSPSHTPTHSRSNTRT
LLSSPPKLPSKQPPTPDTEKDILHPSTFTFKPSSYLENGTPLRTIFISPDLRTQFLSLAA
PNTAANLETCGILAGTLISNAFFISRLIIPEQESTPDTCEMLNEAAIFEYCEAEDLMVLG
WIHTHPTQTCFMSSRDLHTQSGYQVMLSESIAIVCAPSHEPSWGVFRLTDPPGLKSVLNC
TRPGLFHPHDETNIYTDALRPGHVFEAKGLDFETVDLRPSTSSQK
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgcctctgaccgtcgagcagatagctcggcaggccggtcagtacgagttcgat
ccccaggtgcctcttcgctactggcttcgctccgccggcttgcttgtcaaagaggctcga
atatacgaacaagaaggcaacgaccagcaggcctacctccttctcttcagacatgcccag
ctcgtcctcatcaacctcactgcccaccccgacgcccgagacccaaagaacaaacaaggg
ctggccgccgcaaagaaggaagtccaggcttcactcaacaagctggagatactcaaacct
cggatccgcaggctacacgaccggtaccaggagctccagcagcgcagtcaagctgagaac
catgctgcggccactaccactgcatctacaatggaggatcacaccgcaaccaccttctcc
gatctagatgctaccattcaaagcgcaaccacagtgcaagacccagcgctggcaggccga
ccagaggcactgcaggctgctgaaaacagagactttgccgtcagactggcccagagcgag
ttcaggcgcagggcctttgcgcgtggagatgccaggcggccgtcatacgccagctcggag
gccagtgttagtaccgccaacaccgccaacactaccaatactgccaagatggaaggagat
gtactcgcaaggagactgcaggaggttagatccatgcttagcagcggcctatcaaagtct
aatactacttcttcttcctctcctacctcgagatcgcccactctcatgcctatagagcag
catctctccggatacagatacccttctatcccaagacagagctgccaacaccatcatacc
ggctcccactctcctatccggcccccaaagatcgaacaggcaccaccagtcccaggaaag
acaccaaccatacccgctaagatacccgacccagacatcacctcctcctccaccgctgcg
tcaactacctctcttcttcccccactaccaagcaaagtgcctcccttacctcctagggca
ggctcagtgactccttcgccctcacacacccctacccactcacgctccaacacccgcacc
cttctctcttctcctccaaagctaccttccaagcaacctcctaccccagacacagagaag
gacatcctccacccctcaacattcaccttcaagccatcctcctacctcgaaaatggtact
cctctccgcacaatcttcatctctcctgatctacgtacccaattcctctccctcgccgcc
cccaacactgccgctaacctagagacatgcggcatcctagcgggcaccctcatatcaaac
gcattttttatttcgcggcttattatcccagagcaagaatctaccccagatacatgcgaa
atgctcaatgaggctgctatattcgagtactgcgaggcagaagatctcatggttttaggc
tggatccacactcacccgacacaaacttgtttcatgagctcaagagacctgcatacccag
tccggctatcaagtaatgctgtcagagagtatcgccattgtctgtgcacccagccacgag
ccgagctggggtgtttttcgattgacggaccccccgggcctgaaatcagtgttgaactgt
actcgacctggcttgttccacccccacgacgagacaaatatatataccgacgccctgcgg
ccaggacatgtgtttgaagcaaaaggtctagattttgagactgttgacttacgaccatcg
acatcgtcacagaaatga

DBGET integrated database retrieval system