KEGG   Trichophyton verrucosum: TRV_03656Help
Entry
TRV_03656         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tve  Trichophyton verrucosum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tve00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 607 aa AA seqDB search
MASNDPRPSNDTDRNDEESTLLTGERVSRTINDDSRRSPNFWRQVGLFTWALVATAAVIV
LAIVYQHDHSLPQDPHRARHTGKRNMIFMVSDGMGPTSLSMTRSFRQHVDKLPIDDILTL
DKHHIGSSRTRSSSSLVTDSAAGATAFACGKKSYNGAISVLPDHSPCGTVLEAAKAAGYM
TGLVVTTRITDATPACFSSHVNIRGYEDLIAEHQLGEYPLGVQVDLMMGGGRCHFLPNST
SGSCRADDKDLVKLAQSKGFHYFDDRKGFDALKKGEAAKLPLLGLLAPTDIPYEIDRRYR
EKEFPSLEEMTRTALRTLSDATKDSEHGFFIMIEGSRIDHAGHGNDPAAQVHEVLTYDKA
FAAVLEFLENDSTPGVLVSTSDHETGGLAAARQLHESYPEYLWLPDALANATHSSEYLEP
KLNAYLEGQGHGQSREEKRKHIREKFIKPALGIVDTTDEEIDRLIDNTGRPAAYLFADLV
SRRAQIGWSTHGHSAADVSIFASSPHDALPLVGNHENTEVGGFIATYLDLDLDAITKKLK
GVKTKPSTSSEESASDYSWMGKPLDKNVIVDQLDTYHGDFKRRLRKRGPDEEPVHQGRSD
CGCGNHR
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaacgaccctcgcccatcgaacgacacggaccgaaacgatgaagagtctacc
cttctgaccggggagcgggtcagccgtactatcaacgatgattcccgtcgtagccctaac
ttctggcgtcaagttggactctttacttgggctctcgtcgctactgctgccgttatcgtc
cttgcaatcgtctaccagcatgaccattccctgccccaagacccccatagagctaggcac
actgggaaacggaacatgatattcatggtatccgatggaatggggcctacgagcttgtct
atgactcgctctttcaggcagcatgttgacaagcttcctatcgacgatatcctgaccctg
gacaaacaccatatcggatcatccagaacgaggtcttccagcagcctggtgacagattca
gccgccggagccaccgccttcgcatgtgggaagaagagttataacggtgccatatcggtt
cttcctgaccactcaccctgtggaaccgtcttggaagctgctaaggcagcaggttacatg
accggtttggtcgtcactacacgaatcaccgatgccactcctgcctgcttctcttcccat
gtgaacattcgtggctatgaagatctgattgctgaacaccagcttggtgaataccctctc
ggtgtacaggttgatcttatgatgggtgggggtagatgccacttcctgcccaactctacc
tccgggtcttgtcgtgccgatgacaaggatttggtcaagcttgcgcagtctaagggcttc
cattactttgatgaccgcaaaggattcgatgctctgaagaaaggcgaagctgccaaactg
ccgttgctaggtctcctggccccaactgatattccttatgaaattgatcgacgataccgg
gagaaagagttcccgtctttggaggagatgaccagaactgccctcaggacacttagtgat
gccaccaaggatagcgagcatggtttcttcatcatgattgagggctcgagaattgatcat
gctggtcacggtaacgacccagctgctcaggtccatgaggttttgacatatgacaaggca
tttgcagctgttctagaattccttgaaaacgactctacccccggtgttctcgtcagcaca
tccgaccacgaaaccggtggtctggccgctgcaagacagctccatgaatcatacccagag
tacctctggcttcccgatgctcttgctaatgctactcattcctctgagtacctcgagccc
aagttgaacgcctacctagaaggacaaggtcatggccaatcccgagaggaaaagcgcaag
catattcgcgagaaattcatcaagcctgctctaggaatcgtcgacaccactgacgaggaa
attgatcgtctgatcgataacaccggcagacctgctgcgtatctttttgccgaccttgta
agtcgcagagcccagataggctggagcacccacggccactctgccgctgatgttagcatc
tttgcttcgtctcctcatgacgctctcccactggttggtaaccacgaaaacactgaagtg
ggcggattcatcgctacctaccttgaccttgacctagatgctatcactaaaaagttgaag
ggtgttaagactaagccctcaactagcagtgaagaatctgcatccgactactcttggatg
ggtaagccgcttgacaagaatgtgattgtcgaccagcttgatacctatcacggagacttc
aagcgtcgtctaagaaagagaggccctgatgaggagcctgtacatcaaggacgatcagat
tgtggttgtggcaatcatcgatag

DBGET integrated database retrieval system