KEGG   Trichophyton verrucosum: TRV_03717Help
Entry
TRV_03717         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
tve  Trichophyton verrucosum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TRV_03717
   01210 2-Oxocarboxylic acid metabolism
    TRV_03717
   01230 Biosynthesis of amino acids
    TRV_03717
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TRV_03717
Enzymes [BR:tve01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     TRV_03717
Amino acid related enzymes [BR:tve01007]
 Aminotransferase (transaminase)
  Class I
   TRV_03717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 482 aa AA seqDB search
MATPRMNRTNINPNVINAQYAVRGELAVKAEEYRLALERGEKLPFDKVIFANIGNPQQLE
QKPITFSRQVLSLLEYPPLLQNEEALKSTFGYKSDVIARAKTLLADVQSVGAYSQSLGAP
GIRQSVADFIARRDGFPASQKDIYLTGGASAGVSTILNVICAGKKTGVLVPIPQYPLYTA
TLSLLDATCVPYYLNESQSWATDVEEIKTSLANGEKAGTDIRAIVIINPGNPTGASLNPA
AIKDVIDIAAEKSLVIIADEVYQTNVFKGEFTSFKKRLRELQAEFPGKYDGIELVSLHSV
SKGMVGECGHRGGYFELVGFKPEVVEQVYKFVSINLCPPVIGQCLLECMVHPPVEGEESN
ELYQKEYNSIADGLKQRAFALYEAFKKMEGVECQEPQGAMYLFPTIHLPPKAVDAATKAG
RKADEFYCLRLLDATGVCVVPGSGFGQKEGTLHFRTTFLAPGTDWVDRIVKFHGEFMNEF
RG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgactccccgtatgaacaggactaatatcaaccccaacgttatcaacgcgcagtat
gctgtccgaggagagctggcggtgaaagcagaagagtaccgactcgctcttgaaagaggc
gagaagctgccattcgataaggtcatcttcgccaacatcgggaatccgcaacagctcgaa
caaaagcccatcaccttctcccgccaggtgctgagtctcttggagtaccctcccctcctc
cagaacgaagaagccctcaagtcgacctttggatacaaatcggacgttattgcgcgggca
aagacgctgctagcagatgtccagagtgttggtgcatacagccagagtctgggagcaccg
ggtatcagacaaagtgttgcagacttcatcgcccgccgagacggattcccggccagccag
aaagatatctacttgactggaggtgcatctgcgggagttagcactattctgaacgttatc
tgcgctggcaaaaagactggagtgcttgttcccatcccccaataccctctgtacaccgca
actctctccttgctcgacgctacatgcgtgccatactacctgaatgaatctcaatcttgg
gccacagatgtcgaagagattaaaacctctcttgctaacggcgagaaggctggaacagac
attcgtgccattgtgattatcaaccctggaaaccccactggagccagcctcaatcccgcg
gccatcaaggatgtaattgatattgccgccgaaaagagcctggtcatcatagccgacgaa
gtataccagaccaacgttttcaagggcgagttcacatccttcaagaaacgtctacgtgag
ctccaggctgagttccctggtaagtacgatggcattgagctggtttcactacactcagtc
tccaagggaatggtcggtgaatgcggccatcgaggaggatattttgaactcgtcggtttc
aaacctgaagtggtcgagcaggtctacaaattcgtgagcatcaatctctgtccacctgtg
atcggccagtgtttgctcgagtgtatggttcacccgccagtggaaggtgaggagagcaac
gaactatatcagaaggagtacaacagtattgccgacggactcaagcagcgtgcgtttgct
ttgtatgaagccttcaagaagatggagggcgtcgaatgtcaagagcctcagggagctatg
tatctcttcccaaccatccatctaccacccaaggccgttgatgctgccaccaaggcaggc
cgtaaggcagacgagttctactgtctccgtctcctcgatgcgacaggtgtctgtgtcgtc
cccggctcaggctttggacagaaggagggcactctgcacttccgcacgaccttcctagca
cctggaactgactgggtagaccgcattgtcaaattccacggtgaatttatgaatgaattt
agaggttaa

DBGET integrated database retrieval system