KEGG   Trichophyton verrucosum: TRV_03717Help
Entry
TRV_03717         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
tve  Trichophyton verrucosum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:tve01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:tve01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tve01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tve00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 482 aa AA seqDB search
MATPRMNRTNINPNVINAQYAVRGELAVKAEEYRLALERGEKLPFDKVIFANIGNPQQLE
QKPITFSRQVLSLLEYPPLLQNEEALKSTFGYKSDVIARAKTLLADVQSVGAYSQSLGAP
GIRQSVADFIARRDGFPASQKDIYLTGGASAGVSTILNVICAGKKTGVLVPIPQYPLYTA
TLSLLDATCVPYYLNESQSWATDVEEIKTSLANGEKAGTDIRAIVIINPGNPTGASLNPA
AIKDVIDIAAEKSLVIIADEVYQTNVFKGEFTSFKKRLRELQAEFPGKYDGIELVSLHSV
SKGMVGECGHRGGYFELVGFKPEVVEQVYKFVSINLCPPVIGQCLLECMVHPPVEGEESN
ELYQKEYNSIADGLKQRAFALYEAFKKMEGVECQEPQGAMYLFPTIHLPPKAVDAATKAG
RKADEFYCLRLLDATGVCVVPGSGFGQKEGTLHFRTTFLAPGTDWVDRIVKFHGEFMNEF
RG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgactccccgtatgaacaggactaatatcaaccccaacgttatcaacgcgcagtat
gctgtccgaggagagctggcggtgaaagcagaagagtaccgactcgctcttgaaagaggc
gagaagctgccattcgataaggtcatcttcgccaacatcgggaatccgcaacagctcgaa
caaaagcccatcaccttctcccgccaggtgctgagtctcttggagtaccctcccctcctc
cagaacgaagaagccctcaagtcgacctttggatacaaatcggacgttattgcgcgggca
aagacgctgctagcagatgtccagagtgttggtgcatacagccagagtctgggagcaccg
ggtatcagacaaagtgttgcagacttcatcgcccgccgagacggattcccggccagccag
aaagatatctacttgactggaggtgcatctgcgggagttagcactattctgaacgttatc
tgcgctggcaaaaagactggagtgcttgttcccatcccccaataccctctgtacaccgca
actctctccttgctcgacgctacatgcgtgccatactacctgaatgaatctcaatcttgg
gccacagatgtcgaagagattaaaacctctcttgctaacggcgagaaggctggaacagac
attcgtgccattgtgattatcaaccctggaaaccccactggagccagcctcaatcccgcg
gccatcaaggatgtaattgatattgccgccgaaaagagcctggtcatcatagccgacgaa
gtataccagaccaacgttttcaagggcgagttcacatccttcaagaaacgtctacgtgag
ctccaggctgagttccctggtaagtacgatggcattgagctggtttcactacactcagtc
tccaagggaatggtcggtgaatgcggccatcgaggaggatattttgaactcgtcggtttc
aaacctgaagtggtcgagcaggtctacaaattcgtgagcatcaatctctgtccacctgtg
atcggccagtgtttgctcgagtgtatggttcacccgccagtggaaggtgaggagagcaac
gaactatatcagaaggagtacaacagtattgccgacggactcaagcagcgtgcgtttgct
ttgtatgaagccttcaagaagatggagggcgtcgaatgtcaagagcctcagggagctatg
tatctcttcccaaccatccatctaccacccaaggccgttgatgctgccaccaaggcaggc
cgtaaggcagacgagttctactgtctccgtctcctcgatgcgacaggtgtctgtgtcgtc
cccggctcaggctttggacagaaggagggcactctgcacttccgcacgaccttcctagca
cctggaactgactgggtagaccgcattgtcaaattccacggtgaatttatgaatgaattt
agaggttaa

DBGET integrated database retrieval system